DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13950 and Lgals2

DIOPT Version :10

Sequence 1:NP_608553.1 Gene:CG13950 / 33267 FlyBaseID:FBgn0031289 Length:316 Species:Drosophila melanogaster
Sequence 2:XP_038934274.1 Gene:Lgals2 / 171134 RGDID:621269 Length:168 Species:Rattus norvegicus


Alignment Length:150 Identity:31/150 - (20%)
Similarity:51/150 - (34%) Gaps:34/150 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 GHVLIVSGRVKPHPNKISLDLTDNVNAQNESETVFLKIEANFREGQIIRSMFQPGGGWQQEEISK 79
            |..|.:.|::....|..:::|...      .||:.|.....|.|..|:.:... |..|.||: .:
  Rat    15 GMSLKIKGKIHNDVNSFTINLGQG------KETLNLHFNPRFNESTIVCNTLD-GSSWGQEQ-RE 71

  Fly    80 NWKCDGPKNPL--------------QPGQSFTFRVAVLQRCFEIYVNDQLYGSFEFVKFPKQINY 130
            |..|..|.:.:              :||:.....|..|.|     ::.|       ...|.|:..
  Rat    72 NHSCFSPGSEVKVRSKGSPKVVLLPRPGEPHQAPVRTLPR-----LSSQ-------ASSPLQLTL 124

  Fly   131 VRTYGDFEKITQFHHRMLFP 150
            .....||:......|.:.||
  Rat   125 TFQDKDFKVTLPDGHSLTFP 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13950NP_608553.1 Gal-bind_lectin 10..144 CDD:459768 28/142 (20%)
Gal-bind_lectin 170..299 CDD:459768
Lgals2XP_038934274.1 GLECT 5..168 CDD:214596 30/149 (20%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.