DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13950 and Lgals7

DIOPT Version :9

Sequence 1:NP_001334728.1 Gene:CG13950 / 33267 FlyBaseID:FBgn0031289 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_032522.2 Gene:Lgals7 / 16858 MGIID:1316742 Length:136 Species:Mus musculus


Alignment Length:149 Identity:34/149 - (22%)
Similarity:50/149 - (33%) Gaps:37/149 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 VPFGHVLIVSGRVKPHPNKISLDL----TDNVNAQ-------NESETVFLKIEANFREGQIIRSM 65
            |..|.|:.:.|.|.....:..::|    ....:|.       :.||.||     |.:|       
Mouse    14 VRVGTVMRIRGMVPDQAGRFHVNLLCGEEQGADAALHFNPRLDTSEVVF-----NTKE------- 66

  Fly    66 FQPGGGWQQEEISKNWKCDGPKNPLQPGQSFTFRVAVLQRCFEIYVNDQLYGSFEFVKFPKQINY 130
               .|.|.:||       .|...|.:.||.|...:...:..|:..|.|..|..|.....|.::..
Mouse    67 ---QGKWGREE-------RGTGIPFERGQPFEVLLIATEEGFKAVVGDDEYLHFHHRMPPARVRL 121

  Fly   131 VRTYGDFEKITQFHHRMLF 149
            |...||    .|.|...:|
Mouse   122 VEVGGD----VQLHSVKIF 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13950NP_001334728.1 None
Lgals7NP_032522.2 Gal-bind_lectin 5..133 CDD:366037 33/144 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167840829
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3587
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11346
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.