DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13950 and Lgals3

DIOPT Version :9

Sequence 1:NP_001334728.1 Gene:CG13950 / 33267 FlyBaseID:FBgn0031289 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_001139425.1 Gene:Lgals3 / 16854 MGIID:96778 Length:264 Species:Mus musculus


Alignment Length:130 Identity:39/130 - (30%)
Similarity:52/130 - (40%) Gaps:27/130 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   150 PLVFPRTLMCPDKVAFQSDVPRRYET--GTVVAMECIAKGPPTTEFSICFQCNDTGRTVL----- 207
            ||..|..|..|..|     :||...|  |||        .|......:.|:   .|..|.     
Mouse   127 PLTVPYDLPLPGGV-----MPRMLITIMGTV--------KPNANRIVLDFR---RGNDVAFHFNP 175

  Fly   208 RFHVNFDRTTVSRSYQREDNSFALSDEETEGEFPFVRGKLFKIAFGLGDRAFLIAVNGQYFTYYN 272
            ||:.|..|..|..:  ::||::  ..||.:..|||..||.|||...:....|.:|||..:...||
Mouse   176 RFNENNRRVIVCNT--KQDNNW--GKEERQSAFPFESGKPFKIQVLVEADHFKVAVNDAHLLQYN 236

  Fly   273  272
            Mouse   237  236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13950NP_001334728.1 None
Lgals3NP_001139425.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..105
Bindin 18..>110 CDD:251078
9 X 9 AA tandem repeats of Y-P-G-X(3)-P-[GS]-A 35..114
Gal-bind_lectin 137..258 CDD:214904 35/120 (29%)
Beta-galactoside binding. /evidence=ECO:0000250 195..201 2/7 (29%)
Nuclear export signal 240..255
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3587
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11346
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.