DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13950 and Lgals1

DIOPT Version :9

Sequence 1:NP_001334728.1 Gene:CG13950 / 33267 FlyBaseID:FBgn0031289 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_032521.1 Gene:Lgals1 / 16852 MGIID:96777 Length:135 Species:Mus musculus


Alignment Length:118 Identity:30/118 - (25%)
Similarity:41/118 - (34%) Gaps:37/118 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 NKISLDLTDNVNAQNESETVFLKIEANFREGQIIRSMFQPGGGWQQEEISKNWKCDGPKNPLQPG 93
            |.:.|......||..::.|    |..|.:|          .|.|..|...       |..|.|||
Mouse    40 NNLCLHFNPRFNAHGDANT----IVCNTKE----------DGTWGTEHRE-------PAFPFQPG 83

  Fly    94 QSFTFRVAVLQRCFEIYVND---QLYGSFEFVKFPKQ-----INYVRTYGDFE 138
                   ::.:.|......|   :|....|| |||.:     |||:...|||:
Mouse    84 -------SITEVCITFDQADLTIKLPDGHEF-KFPNRLNMEAINYMAADGDFK 128

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13950NP_001334728.1 None
Lgals1NP_032521.1 GLECT 11..135 CDD:214596 30/118 (25%)
Beta-galactoside binding. /evidence=ECO:0000250 45..49 0/3 (0%)
Beta-galactoside binding. /evidence=ECO:0000250 69..72 1/2 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167840832
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3587
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11346
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.