DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13950 and LOC1278417

DIOPT Version :10

Sequence 1:NP_608553.1 Gene:CG13950 / 33267 FlyBaseID:FBgn0031289 Length:316 Species:Drosophila melanogaster
Sequence 2:XP_318003.2 Gene:LOC1278417 / 1278417 VectorBaseID:AGAMI1_007204 Length:145 Species:Anopheles gambiae


Alignment Length:140 Identity:32/140 - (22%)
Similarity:53/140 - (37%) Gaps:39/140 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 GHVLIVSGRVKPHPNKISLDLTDNVNAQNESETVFLKIEANFREG--QIIRSMFQPGGGWQQEEI 77
            |..:||.|.:......|:|.....|:.::::     .:..:.|.|  :|:|:.: ....||.|| 
Mosquito    25 GKKIIVQGTLTADRFNINLQYGPEVDPRDDT-----ALHLSIRPGDRRIVRNTY-VDQCWQDEE- 82

  Fly    78 SKNWKCDGPKNPLQPGQSFTFRVAVLQRCFEIYVNDQLYGSFEFVKFPKQINYVRTYGDFEKITQ 142
             ::..|     |:..|:.||..:.|....:.|..||                        ||...
Mosquito    83 -RSGGC-----PISTGEPFTLEIRVKDTHYSIRFND------------------------EKYCT 117

  Fly   143 FHHRMLFPLV 152
            |.|||.|.:|
Mosquito   118 FSHRMPFEMV 127

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13950NP_608553.1 Gal-bind_lectin 10..144 CDD:459768 26/130 (20%)
Gal-bind_lectin 170..299 CDD:459768
LOC1278417XP_318003.2 Gal-bind_lectin 20..142 CDD:459768 32/140 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.