DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13950 and Lgals8

DIOPT Version :9

Sequence 1:NP_001334728.1 Gene:CG13950 / 33267 FlyBaseID:FBgn0031289 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_446314.2 Gene:Lgals8 / 116641 RGDID:621272 Length:316 Species:Rattus norvegicus


Alignment Length:329 Identity:73/329 - (22%)
Similarity:119/329 - (36%) Gaps:83/329 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 GHVLIVSGRVKPHPNKISLDLTDNVNAQNESETVFLKIEANFREGQIIRSMFQPGGGWQQEEISK 79
            |.::::.|.|.....:..:|.....:.:..::..| .....|:....|.........|..|||:.
  Rat    29 GSLIVIRGHVPKDSERFQVDFQHGNSLKPRADVAF-HFNPRFKRSNCIVCNTLTNEKWGWEEITH 92

  Fly    80 NWKCDGPKNPLQPGQSFTFRVAVLQRCFEIYVNDQLYGSFEFVKFPKQIN--YVRTYGDFEKITQ 142
            :.       |.:..:||...:.||:..|::.||.:     ..:.:..:||  .:.|.|.:.|:. 
  Rat    93 DM-------PFRKEKSFEIVIMVLKNKFQVAVNGK-----HILLYAHRINPEKIDTLGIYGKVN- 144

  Fly   143 FHHRMLFPLVFPRTLMCPDKVAFQSDVPRRYETGTV----VAMECIAKGPPTTEFSICFQCN--- 200
             .|.:.|              .|.||: :..||.|:    ::.|.|.|. .....|:.|:..   
  Rat   145 -IHSIGF--------------RFSSDL-QSMETSTLGLTQISKENIQKS-GKLHLSLPFEARLNA 192

  Fly   201 --DTGRTV------------------------LRFHVNFDRTTVSRSYQREDNSFALSDEETEGE 239
              ..||||                        :..|:| .|..| :::.|  ||| |.|...|.|
  Rat   193 SMGPGRTVVVKGEVNTNAKSFNVDLVAGRSRDIALHLN-PRLNV-KAFVR--NSF-LQDAWGEEE 252

  Fly   240 -----FPFVRGKLFKIAFGLGDRAFLIAVNGQYFTYYNFPGRPF-SISTLKCFTNEVGDFAVRSL 298
                 |||..|..|::......|.|.:||||.:...|....:.. ||.||..      |..:|.|
  Rat   253 RNITCFPFSSGMYFEMIIYCDVREFKVAVNGVHSLEYKHRFKDLSSIDTLAV------DGDIRLL 311

  Fly   299 EYHS 302
            :..|
  Rat   312 DVRS 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13950NP_001334728.1 None
Lgals8NP_446314.2 Gal-bind_lectin 24..148 CDD:214904 25/133 (19%)
Gal-bind_lectin 194..313 CDD:214904 35/129 (27%)
Beta-galactoside binding. /evidence=ECO:0000250 248..254 2/5 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3587
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11346
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.