DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13950 and lgals1.4

DIOPT Version :10

Sequence 1:NP_608553.1 Gene:CG13950 / 33267 FlyBaseID:FBgn0031289 Length:316 Species:Drosophila melanogaster
Sequence 2:XP_017949150.2 Gene:lgals1.4 / 100485527 XenbaseID:XB-GENE-22064451 Length:142 Species:Xenopus tropicalis


Alignment Length:100 Identity:30/100 - (30%)
Similarity:37/100 - (37%) Gaps:23/100 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   201 DTGRTVLRFHVNFD-----RTTVSRSYQREDNSFALSDEETEGEFPFVRGKLFKIAFGLGDR--- 257
            |....|:.|:..||     ...|..|.|..    ....|:.|..|||.:|....|||...:.   
 Frog    43 DADNLVIHFNPRFDFSDDKNIIVCNSTQNN----VWGSEQREPAFPFQKGTETMIAFKFENDIRV 103

  Fly   258 --------AFLIAV--NG-QYFTYYNFPGRPFSIS 281
                    ||.|.|  :| ||...|||..|..||:
 Frog   104 KLPDGRQFAFPIRVPTDGIQYLALYNFHLRSISIN 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13950NP_608553.1 Gal-bind_lectin 10..144 CDD:459768
Gal-bind_lectin 170..299 CDD:459768 30/99 (30%)
lgals1.4XP_017949150.2 GLECT 16..136 CDD:238025 28/96 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.