DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13950 and lgals8b

DIOPT Version :9

Sequence 1:NP_001334728.1 Gene:CG13950 / 33267 FlyBaseID:FBgn0031289 Length:316 Species:Drosophila melanogaster
Sequence 2:XP_021322933.1 Gene:lgals8b / 100334749 ZFINID:ZDB-GENE-120727-7 Length:320 Species:Danio rerio


Alignment Length:300 Identity:62/300 - (20%)
Similarity:110/300 - (36%) Gaps:59/300 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 VPF----------GHVLIVSGRVKPHPNKISLDLTDNVNAQNESETVFLKIEANFREGQIIRSMF 66
            |||          |.::|:.|.|:.:.::...|||...:.:..::..| .....|.....|...|
Zfish    15 VPFTEIIPNGLHTGEMIIIQGCVQNNADRFQFDLTCGCSTKPRADVAF-HFNPRFSSSPRIVCNF 78

  Fly    67 QPGGGWQQEEISKNWKCDGPKNPLQPGQSFTFRVAVLQRCFEIYVNDQLYGSFEFVKFP-KQINY 130
            .....|.:||       :....|.:.|.||...:.||...|::.||......::. :.| :.:|.
Zfish    79 LHHENWGKEE-------NVDLMPFKQGASFETIIMVLCDVFKVAVNGVHILEYKH-RIPLEMVNT 135

  Fly   131 VRTYGDFE---------KITQFHHRMLFPLVFPRTLM----C--PDKVAFQSDVPRRYE----TG 176
            ....|:.|         .::..|   |:..:|...::    |  ..|.:..||:...|:    .|
Zfish   136 FSVSGNVEVHAIGFIPDSVSDIH---LWCNIFTHLILLFQICYYTGKFSNSSDLSIPYKGSLLRG 197

  Fly   177 TVVAMECIAKGPPTT---EFSICFQCNDTGRTVLRF--HVNFDR----TTVSRSYQREDNSFALS 232
            .:...:...||..:.   .|::..:|..:....|..  |:...:    :.:|:|:..|:..... 
Zfish   198 VIPGQQITIKGHISLFPHSFTVNLRCGQSNNIALHIYSHIKSGKLIRNSLLSQSWGPEERELPY- 261

  Fly   233 DEETEGEFPFVRGKLFKIAFGLGDRAFLIAVNGQYFTYYN 272
                   |||..|..|:|........|.|||||.:...||
Zfish   262 -------FPFSAGNYFEIIILCQLHQFKIAVNGSHLLDYN 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13950NP_001334728.1 None
lgals8bXP_021322933.1 Gal-bind_lectin 22..147 CDD:214904 27/133 (20%)
Gal-bind_lectin 196..318 CDD:214904 23/106 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3587
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11346
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.