DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13950 and lgals1.3

DIOPT Version :9

Sequence 1:NP_001334728.1 Gene:CG13950 / 33267 FlyBaseID:FBgn0031289 Length:316 Species:Drosophila melanogaster
Sequence 2:NP_001135709.1 Gene:lgals1.3 / 100216286 XenbaseID:XB-GENE-5849758 Length:135 Species:Xenopus tropicalis


Alignment Length:122 Identity:30/122 - (24%)
Similarity:51/122 - (41%) Gaps:15/122 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 GHVLIVSGRVKPHPNKISLDLTDNVNAQNESETVFLKIEANFREGQIIRSMFQPG-GGWQQEEIS 78
            ||.:.|.||:.....:.::|:  ..:|:|.......:.|.:..:..||.:..|.| .|.:|:|.:
 Frog    17 GHRVEVRGRILKDTKRFAVDM--GADAENLIMHCNPRFEFSVDKNTIIFNSKQNGVWGTEQKETA 79

  Fly    79 KNWKCDGPKNPLQPGQSFTFRVAVLQRCFEIYVNDQLYGSFEFVKFP-KQINYVRTY 134
                     .|.|.| |.|..:...:.|..:.:.|.....|. .:|| ..|||:..|
 Frog    80 ---------FPFQAG-SETMLIFEFEDCITVLLPDGTEVPFT-CRFPIDVINYLALY 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13950NP_001334728.1 None
lgals1.3NP_001135709.1 GLECT 13..135 CDD:214596 30/122 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11346
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.