DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13950 and lgals8

DIOPT Version :9

Sequence 1:NP_001334728.1 Gene:CG13950 / 33267 FlyBaseID:FBgn0031289 Length:316 Species:Drosophila melanogaster
Sequence 2:XP_031757424.1 Gene:lgals8 / 100216105 XenbaseID:XB-GENE-494605 Length:319 Species:Xenopus tropicalis


Alignment Length:201 Identity:49/201 - (24%)
Similarity:77/201 - (38%) Gaps:48/201 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   139 KITQFHHRMLFPLVFPRTLMCPDKVAFQSDVPRRYETGTVVAMECIAKGPPTTE---FSICFQCN 200
            |:.|..|:        ||::.| .|.:...:....|.|.:|    :..|...::   |.|.|||.
 Frog     4 KMAQTGHQ--------RTILNP-VVPYVGTIFGGLEPGQMV----VVHGTVPSDADRFQIDFQCG 55

  Fly   201 DT--GRTVLRFHVN--FDRT--TVSRSYQREDNSFALSDEETEGEFPFVRGKLFKIAFGLGDRAF 259
            .:  .|:.:.||.|  |..:  .|..:.|.|...:    ||.....||.:|:.|::.|.:....|
 Frog    56 SSIHPRSDVAFHFNPRFKGSGHIVCNTLQNEKWGW----EEKTYHLPFTKGQPFEVIFLVFHHKF 116

  Fly   260 LIAVNGQYFTYYNFPGRPFSISTL----KCFTNEVG-------------DFAVRSLEYHSDSPLL 307
            .::.||:....|........:.||    |...|.:|             .|||.|:|.:.     
 Frog   117 QVSSNGKNLLVYKHRIGLEKVDTLGISGKVKINSIGFLSQPTILGSQPTSFAVNSIEGNQ----- 176

  Fly   308 ARVEKL 313
            .|.|||
 Frog   177 GRSEKL 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13950NP_001334728.1 None
lgals8XP_031757424.1 Gal-bind_lectin 27..151 CDD:214904 32/131 (24%)
Gal-bind_lectin 194..316 CDD:214904
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11346
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.