DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13950 and lgals9l6

DIOPT Version :9

Sequence 1:NP_001334728.1 Gene:CG13950 / 33267 FlyBaseID:FBgn0031289 Length:316 Species:Drosophila melanogaster
Sequence 2:XP_001921992.1 Gene:lgals9l6 / 100148547 ZFINID:ZDB-GENE-131119-90 Length:281 Species:Danio rerio


Alignment Length:285 Identity:68/285 - (23%)
Similarity:106/285 - (37%) Gaps:69/285 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 VPF----------GHVLIVSGRVKPHPNKISLDLTDNVNAQNESE---TVFLKIEANFREG--QI 61
            :||          |..||:.|.|.|..|:.      .||.|:.:|   .:.|..:..|.:|  .|
Zfish    14 IPFSGPLLGGLQEGKTLIIIGHVLPTANEF------GVNLQHATECGTDIALHFKPCFNDGPAYI 72

  Fly    62 IRSMFQPGGGWQQEEISKNWKCDGPKNPLQPGQSFTFRVAVLQRCFEIYVNDQLYGSFEFVKFPK 126
            :.:.|:. |.|..||.|   .|     ||..||:||....|.:..:::.||.             
Zfish    73 VFNTFEK-GSWGLEEKS---AC-----PLIKGQTFTLEFHVTKEAYKVSVNG------------- 115

  Fly   127 QINYVRTYGDFEKITQFHHRMLFPLV----FPRTLMCPDKVAFQSDVPRRYET----GTVVAMEC 183
                       :.:..:.||:.|.||    ..:|:.. |.:|:|......|.|    |.....:.
Zfish   116 -----------KHLADYKHRIPFTLVDTISVHKTVEL-DFIAYQKPATVPYTTLISDGLKSGKDI 168

  Fly   184 IAKGPPTTEFSICFQCNDTGRTVLRFH--VNFDRTTVSRSYQREDNSFALSDEETEGEFPFVRGK 246
            :..|.|..: |...:.|...|..:.||  ..||:..|..:........|   ||..|..||:||:
Zfish   169 VIHGVPNAD-SKRMEFNLRHRFGIAFHYQCRFDQNAVVCNTWENGKWGA---EEKHGPVPFIRGQ 229

  Fly   247 LFKIAFGLGDRAFLIAVNGQYFTYY 271
            .|::........:.:.|||:....|
Zfish   230 FFQVKISCHSDHYDVFVNGKQTHIY 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13950NP_001334728.1 None
lgals9l6XP_001921992.1 Gal-bind_lectin 22..144 CDD:214904 38/161 (24%)
Gal-bind_lectin 161..279 CDD:214904 24/98 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3587
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11346
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.