DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4291 and AT1G49590

DIOPT Version :9

Sequence 1:NP_001259846.1 Gene:CG4291 / 33264 FlyBaseID:FBgn0031287 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_175382.1 Gene:AT1G49590 / 841383 AraportID:AT1G49590 Length:242 Species:Arabidopsis thaliana


Alignment Length:295 Identity:66/295 - (22%)
Similarity:107/295 - (36%) Gaps:116/295 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTEYWKSNERKFCDFCKCWLSDNKASVAFHESGKRHKMNVAKRITDISRNSEKSERERQKMDAEI 65
            |||||.|...|:|:|||.|:.:|..|:..|:.||||:..|.|::||:...|...::|.:|.:..:
plant     1 MTEYWVSQGNKWCEFCKIWIQNNPTSIRNHDLGKRHRECVDKKLTDMRERSAAKDKELKKNEKLL 65

  Fly    66 RKMEEAAMKSYAQDVHSRGDMTARSINTVMRATATAAASGGAHSFAGRSRQVDPMRLEGLSDEEE 130
            :::|..|.:||.:|:     .||:.:         |.|:|                         
plant    66 QQIEAKATRSYQKDI-----ATAQQV---------AKANG------------------------- 91

  Fly   131 DQRRVAPGKVTSDAAVPEASLWVEGKSDEGHTYYWNVKTNESVWKPPKEGYLSYEEYERINQLAI 195
                 ||...|||        |:   .|....||:|                      :.|.|..
plant    92 -----APEDGTSD--------WM---LDSASGYYYN----------------------QTNGLHY 118

  Fly   196 DQQQISQAEESLKFRANVDEEVARVNRE---KMKAFRR---------------------TDNPK- 235
            |.|......:|:......||..|.|...   |:...::                     :.||| 
plant   119 DSQSGFYYSDSIGHWVTQDEAYAAVKTSSGTKVPLVKKPVSSSGAGPSVGKPPGRLVTASLNPKR 183

  Fly   236 --------------EKKQKEERRQTFKTEEEAATK 256
                          ::|:::|:.:....||:||.|
plant   184 AVKGAASSVDLGNNKRKRQDEKPKKVSAEEKAALK 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4291NP_001259846.1 zf-U1 10..44 CDD:277622 15/33 (45%)
WW 152..177 CDD:278809 5/24 (21%)
AT1G49590NP_175382.1 zf-U1 8..42 CDD:389966 14/33 (42%)
OCRE_ZOP1_plant 93..142 CDD:293884 16/81 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0150
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004807
OrthoInspector 1 1.000 - - oto3277
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR13173
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X4650
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.000

Return to query results.
Submit another query.