DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment drongo and SPS18

DIOPT Version :9

Sequence 1:NP_001162848.1 Gene:drongo / 33263 FlyBaseID:FBgn0020304 Length:673 Species:Drosophila melanogaster
Sequence 2:NP_014195.1 Gene:SPS18 / 855517 SGDID:S000005148 Length:300 Species:Saccharomyces cerevisiae


Alignment Length:357 Identity:81/357 - (22%)
Similarity:121/357 - (33%) Gaps:104/357 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 RELVASGTGSNRQCFDCGQKGPTYVNMTIGSFVCTRCSGVLRGL-TPPHRVKSISMATFTQDEID 80
            |.|.|.....|..||:|....|.:|:.:.|.|:|..|:.:|||: |....||||:|..|.:.::.
Yeast    15 RLLRAKKAAGNNNCFECKSVNPQFVSCSFGIFICVNCANLLRGMGTNIFCVKSITMDNFEEKDVR 79

  Fly    81 FLRSHGNELCAKTWLGLWDPKRAVHQ------QEQRELMMDKYERKRYYLEPASPLKSLANAVNL 139
            .:...||..     .|.:..|..:.|      ::...|....|:|:            |||.|  
Yeast    80 RVEKSGNNR-----FGSFLSKNGILQNGIPLREKYDNLFAKSYKRR------------LANEV-- 125

  Fly   140 KSSAPATNHTQNGHQNGYASIHLTPPAAQRTSANGLQKVANSSSNSSGKTSSSISRPHYNHQNNS 204
                    .:.:.::|.|...            |..|:..|      |.||....|......|||
Yeast   126 --------RSNDINRNMYLGF------------NNFQQYTN------GATSQIRDRTLREISNNS 164

  Fly   205 QNNNHDAFGLGGGLSSLNSAGSTSTGA--LSDTSSCASNGFGADCD-FVADFGSANIFD---ATS 263
                                 :.|.||  :.......|:.| .||: |.|...|....|   .||
Yeast   165 ---------------------NASEGAEFVLPEKVLGSDNF-QDCERFPACLSSERNLDENNVTS 207

  Fly   264 ARST-------GSP--AVSSVSSVGSSNGYAKVQPIRAAHLQ------QQQQLQQQL-----HQQ 308
            |.||       ..|  .:|....:.|...|...:..:.:.:|      ||:.|...:     |..
Yeast   208 ATSTLTIEKFQNDPIGTISRSWQLLSDALYKSYEDFKGSVVQPTIENIQQRNLPNDIKRSFVHFN 272

  Fly   309 QLLNGNGHQGTENFADFDHAPIYNAVAPPTFN 340
            :.|:...|..:..|:.|....|    .||.||
Yeast   273 EKLHETPHLPSPVFSCFTGGDI----LPPEFN 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
drongoNP_001162848.1 ArfGap 15..126 CDD:279720 31/115 (27%)
SPS18NP_014195.1 COG5347 6..300 CDD:227651 79/355 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5347
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.