DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment drongo and AGE2

DIOPT Version :9

Sequence 1:NP_001162848.1 Gene:drongo / 33263 FlyBaseID:FBgn0020304 Length:673 Species:Drosophila melanogaster
Sequence 2:NP_012220.3 Gene:AGE2 / 854767 SGDID:S000001306 Length:298 Species:Saccharomyces cerevisiae


Alignment Length:275 Identity:67/275 - (24%)
Similarity:113/275 - (41%) Gaps:33/275 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 NRQCFDC-GQKGPTYVNMTIGSFVCTRCSGVLRGL-TPPHRVKSISMATFTQDEIDFLRSHGNEL 89
            |..|.|| .|..|.:.:.::|.|:|.:|:|:.|.| |...:|||:.:.|:.::.:..|....|.|
Yeast    20 NSHCADCKAQLHPRWASWSLGVFICIKCAGIHRSLGTHISKVKSVDLDTWKEEHLVKLIQFKNNL 84

  Fly    90 CAKTWLGLWDPKRAVHQQEQREL---------MMDKYERKRYY--LEPASPLKSLANAVNLKSSA 143
            .|.::.    ......:.:||::         :.:|||.|::.  |.....|......|..|.||
Yeast    85 RANSYY----EATLADELKQRKITDTSSLQNFIKNKYEYKKWIGDLSSIEGLNDSTEPVLHKPSA 145

  Fly   144 ----PATNHTQNGHQNGYASIHLTPP----AAQRTSANGLQKVANSSSNSSGKTSSSISRPHYNH 200
                ||:|...:...|........||    :..|::.:.|....:|.|.::..||.:.|......
Yeast   146 NHSLPASNARLDQSSNSLQKTQTQPPSHLLSTSRSNTSLLNLQVSSLSKTTSNTSVTSSATSIGA 210

  Fly   201 QNNSQNNNHDAFG----LGGGLSSLNSAGSTSTGALSDTSSCASNGFGADCDFVADFGSANIFDA 261
            .|....|....||    |...:.||.|..|..|   ...:|..::.....|:..:.|.:..| .|
Yeast   211 ANTKTGNRVGEFGQRNDLKKSILSLYSKPSAQT---QSQNSFFTSTTPQPCNTPSPFVNTGI-TA 271

  Fly   262 TSARSTGSPAVSSVS 276
            |:..|..|.:.|::|
Yeast   272 TNNNSMNSNSSSNIS 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
drongoNP_001162848.1 ArfGap 15..126 CDD:279720 29/111 (26%)
AGE2NP_012220.3 COG5347 1..298 CDD:227651 67/275 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5347
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.