DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment drongo and AGE1

DIOPT Version :9

Sequence 1:NP_001162848.1 Gene:drongo / 33263 FlyBaseID:FBgn0020304 Length:673 Species:Drosophila melanogaster
Sequence 2:NP_010812.3 Gene:AGE1 / 852136 SGDID:S000002932 Length:482 Species:Saccharomyces cerevisiae


Alignment Length:270 Identity:61/270 - (22%)
Similarity:105/270 - (38%) Gaps:75/270 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 DKYLLALRELVASGTGSNRQCFDCGQKGPT-YVNMTIGSFVCTRCSGVLRGL-TPPHRVKSISMA 72
            |:.|..:|::    ..||.:|.|||..... :|::.:...:|.:||||.|.| :...:::|:::.
Yeast   170 DELLSIVRKI----DKSNLKCCDCGSTATVEWVSINLLCILCIKCSGVHRSLGSHISKIRSLTLD 230

  Fly    73 TFTQDEIDFL------RSHGNELCAKTWLGLWDPKRAV----HQQEQRELMMDKYERKRYYLEP- 126
            .||..|:..|      .|:.|.:........  |.:.:    ...|:.:.::|||:.|::.::. 
Yeast   231 NFTSLELMHLLQNNVSNSNVNAIYESNLRNF--PVKKITANSDDSERSKFIIDKYQFKKFVIDSN 293

  Fly   127 ---ASPLKSLANAVNLKS----------------SAPATNHTQN--GHQN-------GYASIHLT 163
               .:.||||..|::|.|                ...|:...||  .|.:       .|..:..|
Yeast   294 QGREASLKSLIKAIHLDSVFMMQRAIAQSKYSLRELTASEKEQNDLNHSSIFQYSLKHYEIVDGT 358

  Fly   164 PP--AAQRTSANG--LQKVANSSSNSSGK-------------------TSSSISRPHYN-HQN-- 202
            |.  ..:....||  :..:...::|.|.|                   ||...|.||.| |.|  
Yeast   359 PIFFITEFLLCNGIHIDNLPKITTNWSPKVLEYWETKLEMYGTFQAVNTSRPRSGPHLNMHSNVD 423

  Fly   203 --NSQNNNHD 210
              :|.|..||
Yeast   424 SASSYNKKHD 433

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
drongoNP_001162848.1 ArfGap 15..126 CDD:279720 28/122 (23%)
AGE1NP_010812.3 COG5347 164..480 CDD:227651 61/270 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5347
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.