DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment drongo and Appl1

DIOPT Version :9

Sequence 1:NP_001162848.1 Gene:drongo / 33263 FlyBaseID:FBgn0020304 Length:673 Species:Drosophila melanogaster
Sequence 2:NP_660256.1 Gene:Appl1 / 72993 MGIID:1920243 Length:707 Species:Mus musculus


Alignment Length:219 Identity:49/219 - (22%)
Similarity:75/219 - (34%) Gaps:67/219 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   181 SSSNSSGKTSSSISRPHYNHQNNSQNNNHDAFGLGGGLSSLNSAGSTSTGALSDTSSCASNGFGA 245
            ::.|.:|..||:..|..|             |..||.|.| .:.|..:.|...|..:|:.  ...
Mouse   285 NARNKTGLVSSTWDRQFY-------------FTQGGNLMS-QARGDVAGGLAMDIDNCSV--MAV 333

  Fly   246 DCD----------FVADFGSANIFDATSARSTGSPAVSSVSSVGSSNGYAKVQPIRAAHLQQQQQ 300
            ||:          |  |...::|..|.| :......:.::::: |...|....|...|....|..
Mouse   334 DCEDRRYCFQITSF--DGKKSSILQAES-KKDHEEWICTINNI-SKQIYLSENPEETAARVNQSA 394

  Fly   301 LQ--------QQLHQQQLLNG-----------NGHQGTE--NFADFDHAPIYNAVAP--PTFNDW 342
            |:        ||.|:.....|           :|..|:|  |.|...   :.:.|||  |...|.
Mouse   395 LEAVTPSPSFQQRHESLRPGGQSRPPTARTSSSGSLGSESTNLAALS---LDSLVAPDTPIQFDI 456

  Fly   343 ISDWSRRGFHDPFDDCDDSPPGAR 366
            ||         |.  |:|.|..|:
Mouse   457 IS---------PV--CEDQPGQAK 469

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
drongoNP_001162848.1 ArfGap 15..126 CDD:279720
Appl1NP_660256.1 Required for RAB5A binding. /evidence=ECO:0000250 1..428 32/162 (20%)
BAR_APPL1 20..234 CDD:153315
BAR-PH_APPL 252..376 CDD:270067 23/110 (21%)
PH 280..375 CDD:278594 22/109 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 397..433 6/35 (17%)
F&H. /evidence=ECO:0000250 403..414 3/10 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 466..490 1/4 (25%)
PTB_APPL 489..624 CDD:269980
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 636..707
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5347
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.