| Sequence 1: | NP_001162848.1 | Gene: | drongo / 33263 | FlyBaseID: | FBgn0020304 | Length: | 673 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001137472.1 | Gene: | AGAP5 / 729092 | HGNCID: | 23467 | Length: | 686 | Species: | Homo sapiens |
| Alignment Length: | 204 | Identity: | 48/204 - (23%) |
|---|---|---|---|
| Similarity: | 80/204 - (39%) | Gaps: | 34/204 - (16%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 27 NRQCFDCGQKGPTYVNMTIGSFVCTRCSGVLRGL-TPPHRVKSISMATFTQDEIDFLRSHGNELC 90
Fly 91 AKTW----LGLWDPKRAVHQQEQRELMMDKYERKRY-------------YLEPASPLKSLANAVN 138
Fly 139 L--KSSAPATNHTQNGHQNGYASIHL-----TPPAAQRTSANGLQKVANSSSNSSGKTSSSISRP 196
Fly 197 HYNHQNNSQ 205 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| drongo | NP_001162848.1 | ArfGap | 15..126 | CDD:279720 | 28/116 (24%) |
| AGAP5 | NP_001137472.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 205..242 | ||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 256..278 | ||||
| PH_AGAP | 280..447 | CDD:241281 | |||
| PH | 283..442 | CDD:278594 | |||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 382..404 | ||||
| ArfGap | 466..580 | CDD:279720 | 27/103 (26%) | ||
| ANK | <590..677 | CDD:238125 | 21/90 (23%) | ||
| Ank_2 | 591..681 | CDD:289560 | 21/89 (24%) | ||
| ANK repeat | 591..621 | CDD:293786 | 8/30 (27%) | ||
| ANK repeat | 623..654 | CDD:293786 | 7/30 (23%) | ||
| ANK 1 | 623..652 | 6/28 (21%) | |||
| ANK 2 | 656..685 | 5/23 (22%) | |||
| ANK repeat | 656..681 | CDD:293786 | 5/23 (22%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_COG5347 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||