DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment drongo and Smap1

DIOPT Version :9

Sequence 1:NP_001162848.1 Gene:drongo / 33263 FlyBaseID:FBgn0020304 Length:673 Species:Drosophila melanogaster
Sequence 2:XP_003750716.3 Gene:Smap1 / 684800 RGDID:1585595 Length:467 Species:Rattus norvegicus


Alignment Length:406 Identity:93/406 - (22%)
Similarity:161/406 - (39%) Gaps:100/406 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 KKQDDKYLLALRELVASGTGSNRQCFDCGQKGPTYVNMTIGSFVCTRCSGVLRGL-TPPHRVKSI 69
            :|.::::.|.|.:|:..  ..|:.|.||..|||.:.:..||.|:|.||:|:.|.| ....||||:
  Rat    11 QKLNEQHQLILSKLLRE--EDNKYCADCEAKGPRWASWNIGVFICIRCAGIHRNLGVHISRVKSV 73

  Fly    70 SMATFTQDEIDFLRSHGNELCAKTWLGLWDP------KRAVHQQEQRELMMDKYERKRYYLEPA- 127
            ::..:|.::|..::..||   .|..| |::.      :|....|.....:.||||:|:||.:.| 
  Rat    74 NLDQWTPEQIQCMQDMGN---TKARL-LYEANLPENFRRPQTDQAVEFFIRDKYEKKKYYDKNAI 134

  Fly   128 ---------SPLKSLANAVNLKSSAPATNHTQNGHQNGYASIHLTPP--AAQRTSANGLQKVANS 181
                     :||:.|.::.:|.::.......:...:..........|  .|:..:...|||..:.
  Rat   135 AITNISSSDAPLQPLVSSPSLPAAVDKNKIEKEKEKKKEEKKREKEPEKPAKALTTEKLQKKEDQ 199

  Fly   182 SSNSSGKTS-SSISRPHYNHQNNSQNNNHDAFGLGGGLSS-LNSAGSTSTGALSDTSSCASNGFG 244
            .......|| .:::.|           ..|..||.|...: :.:..:|:...|||          
  Rat   200 QPEPKKSTSPKNVAEP-----------TVDLLGLDGPAEAPVTNGNTTAAPPLSD---------- 243

  Fly   245 ADCDFVADFGS--ANIFDAT---SARSTGS-PAVSSVSSVGSSNGYAKVQPIRAAHLQQQQQLQQ 303
             |.|.   ||.  :|...|.   .|:.|.| ||.:::|::.|.:    :........:.::..::
  Rat   244 -DLDI---FGPMISNPLPAAVMPQAQGTASIPAAAALSTITSGD----LDLFTEQTTKSEEGAKK 300

  Fly   304 QLHQQQLLN--GNGHQ--------GTENFADFDHAPIYNAVAPPTFNDWISDWSRRGFHDPFDDC 358
            ||.:..:|:  |.|.|        |..|..       :.:.||..|         :||       
  Rat   301 QLSKDSILSLYGTGAQQSTPGVFMGPTNIP-------FTSQAPTAF---------QGF------- 342

  Fly   359 DDSPPGARPPAPAPAP 374
                |....|.|| ||
  Rat   343 ----PSMGVPVPA-AP 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
drongoNP_001162848.1 ArfGap 15..126 CDD:279720 38/117 (32%)
Smap1XP_003750716.3 ArfGap 20..120 CDD:279720 31/105 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5347
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.