DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment drongo and ARAP3

DIOPT Version :9

Sequence 1:	NP_001162848.1	Gene:	drongo / 33263	FlyBaseID:	FBgn0020304	Length:	673	Species:	Drosophila melanogaster
Sequence 2:	NP_071926.4	Gene:	ARAP3 / 64411	HGNCID:	24097	Length:	1544	Species:	Homo sapiens

Alignment Length:	125	Identity:	33/125 - (26%)
Similarity:	59/125 - (47%)	Gaps:	13/125 - (10%)

- Green bases have known domain annotations that are detailed below.

  Fly    26 SNRQCFDCGQKGPTYVNMTIGSFVCTRCSGVLRGL-TPPHRVKSISMAT--FTQDEIDFLRSHGN 87
            :||||.|||...|.:..:.:|..:|.:|:|..|.| :...:|:|:.:.|  ::.:.:......||
Human   500 ANRQCADCGSSRPDWAAVNLGVVICKQCAGQHRALGSGISKVQSLKLDTSVWSNEIVQLFIVLGN 564

  Fly    88 ELCAKTWLGLWDPKRAVHQQ----EQRELMMDKYE----RKRY--YLEPASPLKSLANAV 137
            :...:.|.|...|...:|..    .:.|.:..||.    ||.:  |.:.:..|::|..||
Human   565 DRANRFWAGTLPPGEGLHPDATPGPRGEFISRKYRLGLFRKPHPQYPDHSQLLQALCAAV 624

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
drongo	NP_001162848.1	ArfGap	15..126	CDD:279720	29/112 (26%)
ARAP3	NP_071926.4	SAM_Arap1,2,3	4..66	CDD:188889
		SAM	12..64	CDD:197735
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	64..147
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	167..194
		PH	288..379	CDD:278594
		PH1_ARAP	289..381	CDD:270073
		PH2_ARAP	398..479	CDD:270074
		PH	399..482	CDD:278594
		ArfGap	490..606	CDD:279720	27/105 (26%)
		PH3_ARAP	676..786	CDD:270076
		PH-like	<846..894	CDD:302622
		RhoGAP_ARAP	909..1084	CDD:239850
		RA	1117..1209	CDD:279168
		PH5_ARAP	1212..1331	CDD:270079
		PH	1241..1325	CDD:278594
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1422..1544
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG5347
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.900