DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment drongo and Adap2

DIOPT Version :9

Sequence 1:NP_001162848.1 Gene:drongo / 33263 FlyBaseID:FBgn0020304 Length:673 Species:Drosophila melanogaster
Sequence 2:XP_038942641.1 Gene:Adap2 / 56826 RGDID:708487 Length:400 Species:Rattus norvegicus


Alignment Length:156 Identity:42/156 - (26%)
Similarity:66/156 - (42%) Gaps:37/156 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 KKQDDKYLLALRELVASGTGSNRQCFDCGQKGPT------------------------YVNMTIG 46
            ::::.|.||.|  |.|:||| |..|.|||..||.                        :.:..:|
  Rat     4 RERNKKRLLEL--LQAAGTG-NGHCADCGAAGPACPCTLVQSLSSSAEILLFHPADPDWASYKLG 65

  Fly    47 SFVCTRCSGVLRGLTPPHRVKSISMATFTQDEIDFLRSHGN-------ELCAKTWLGLWDPKRAV 104
            .|:|..||||.|......:|||:.:..:....::|:..:||       |....|:..:......:
  Rat    66 VFICLHCSGVHRNFPDISKVKSVRLDFWDDSMVEFMTHNGNLSVKAKFEARVPTFYYVPQASDCL 130

  Fly   105 HQQEQRELMMDKYERKRYYLEPA-SP 129
            ..:||  .:..||||:.:..|.| ||
  Rat   131 VLKEQ--WIRAKYERQEFMAEKAVSP 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
drongoNP_001162848.1 ArfGap 15..126 CDD:279720 35/141 (25%)
Adap2XP_038942641.1 ArfGap 4..141 CDD:355783 34/141 (24%)
PH1_ADAP 156..264 CDD:270072
PH2_ADAP 278..385 CDD:241282
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5347
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.