DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment drongo and ADAP2

DIOPT Version :9

Sequence 1:NP_001162848.1 Gene:drongo / 33263 FlyBaseID:FBgn0020304 Length:673 Species:Drosophila melanogaster
Sequence 2:XP_024306599.1 Gene:ADAP2 / 55803 HGNCID:16487 Length:403 Species:Homo sapiens


Alignment Length:206 Identity:50/206 - (24%)
Similarity:79/206 - (38%) Gaps:67/206 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 KKQDDKYLLALRELVASGTGSNRQCFDCGQKGPTYVNMTIGSFVCTRCSGVLRGLTPPHRVKSIS 70
            ::::.|.||.|  |.|..|| |..|.|||...|.:.:..:|.|:|..|.||.|......||||:.
Human     4 RERNKKRLLEL--LRAPDTG-NAHCADCGAADPDWASYKLGIFICLNCCGVHRNFPDISRVKSVR 65

  Fly    71 MATFTQDEIDFLRSHGN-ELCAK----------------------TWLGLWDPKRAVHQQEQREL 112
            :..:....::|:..:|| .:.||                      .|:      ||  :.|:||.
Human    66 LDFWDDSIVEFMIHNGNLRVKAKFEARVPAFYYIPQANDCLVLKEQWI------RA--KYERREF 122

  Fly   113 MMD----------------------KYERKRYYLEPASPL---------KSLANAVNLKSSAPAT 146
            |.|                      ::.|:::.|.....|         ||....:::| ...||
Human   123 MADGETISLPGNREGFLWKRGRDNSQFLRRKFVLLAREGLLKYFTKEQGKSPKAVISIK-DLNAT 186

  Fly   147 NHTQN-GHQNG 156
            ..|:. ||.:|
Human   187 FQTEKIGHPHG 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
drongoNP_001162848.1 ArfGap 15..126 CDD:279720 37/155 (24%)
ADAP2XP_024306599.1 ArfGap 8..126 CDD:307528 37/128 (29%)
PH1_ADAP 133..241 CDD:270072 12/66 (18%)
PH2_ADAP 255..362 CDD:241282
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5347
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.