Sequence 1: | NP_001162848.1 | Gene: | drongo / 33263 | FlyBaseID: | FBgn0020304 | Length: | 673 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_024306599.1 | Gene: | ADAP2 / 55803 | HGNCID: | 16487 | Length: | 403 | Species: | Homo sapiens |
Alignment Length: | 206 | Identity: | 50/206 - (24%) |
---|---|---|---|
Similarity: | 79/206 - (38%) | Gaps: | 67/206 - (32%) |
- Green bases have known domain annotations that are detailed below.
Fly 6 KKQDDKYLLALRELVASGTGSNRQCFDCGQKGPTYVNMTIGSFVCTRCSGVLRGLTPPHRVKSIS 70
Fly 71 MATFTQDEIDFLRSHGN-ELCAK----------------------TWLGLWDPKRAVHQQEQREL 112
Fly 113 MMD----------------------KYERKRYYLEPASPL---------KSLANAVNLKSSAPAT 146
Fly 147 NHTQN-GHQNG 156 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
drongo | NP_001162848.1 | ArfGap | 15..126 | CDD:279720 | 37/155 (24%) |
ADAP2 | XP_024306599.1 | ArfGap | 8..126 | CDD:307528 | 37/128 (29%) |
PH1_ADAP | 133..241 | CDD:270072 | 12/66 (18%) | ||
PH2_ADAP | 255..362 | CDD:241282 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5347 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |