DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment drongo and APPL2

DIOPT Version :9

Sequence 1:NP_001162848.1 Gene:drongo / 33263 FlyBaseID:FBgn0020304 Length:673 Species:Drosophila melanogaster
Sequence 2:NP_001238833.1 Gene:APPL2 / 55198 HGNCID:18242 Length:670 Species:Homo sapiens


Alignment Length:333 Identity:62/333 - (18%)
Similarity:116/333 - (34%) Gaps:96/333 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 MATFTQDEIDFLRSHGNELCAKTWLGLWDPKRAVHQQEQRELMMDKYERKRYYLEPASPLKSLAN 135
            |..|...:|:|.:. |.|:.:|                    .||.:            |.|:|:
Human   206 MIGFAHGQINFFKK-GAEMFSK--------------------RMDSF------------LSSVAD 237

  Fly   136 -----AVNLKSSAPATNHTQNGHQNGYASIHLTPP---AAQRTSANGLQKVAN-SSSNSSGKTSS 191
                 .|.|::.|.....:|....:...|:: ||.   ||.:.:.|.:||... :..|.:|..::
Human   238 MVQSIQVELEAEAEKMRVSQQELLSVDESVY-TPDSDVAAPQINRNLIQKAGYLNLRNKTGLVTT 301

  Fly   192 SISRPHYNHQNNSQNNNHDAFGLGGGLSSLNSAGSTSTGALSDTSSCASNGFGADCD-------F 249
            :..|.::             |..||.| .....|:.:.|.:.|..:|:.  ...||:       .
Human   302 TWERLYF-------------FTQGGNL-MCQPRGAVAGGLIQDLDNCSV--MAVDCEDRRYCFQI 350

  Fly   250 VADFGSANIFDATSARSTGSPAVSSVSSVG----------------SSNGYAKVQPIRAAHLQQQ 298
            ....|.:.|.....:|......:.:::::.                :......|.||.:...:|:
Human   351 TTPNGKSGIILQAESRKENEEWICAINNISRQIYLTDNPEAVAIKLNQTALQAVTPITSFGKKQE 415

  Fly   299 QQL-QQQLHQQQLLNGNGH---QGTENFADFDH-----API-YNAVAPPT-FNDWISDWSRRGFH 352
            ... .|.|...::.|.|..   :.|.:..:.:.     .|| ::.|.|.| |.|. :..|||  .
Human   416 SSCPSQNLKNSEMENENDKIVPKATASLPEAEELIAPGTPIQFDIVLPATEFLDQ-NRGSRR--T 477

  Fly   353 DPFDDCDD 360
            :||.:.:|
Human   478 NPFGETED 485

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
drongoNP_001162848.1 ArfGap 15..126 CDD:279720 9/54 (17%)
APPL2NP_001238833.1 BAR_APPL2 20..240 CDD:153316 12/66 (18%)
BAR-PH_APPL 258..382 CDD:270067 24/140 (17%)
PTB_APPL 488..621 CDD:269980
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 649..670
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5347
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.