DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment drongo and Appl2

DIOPT Version :9

Sequence 1:NP_001162848.1 Gene:drongo / 33263 FlyBaseID:FBgn0020304 Length:673 Species:Drosophila melanogaster
Sequence 2:NP_001102211.1 Gene:Appl2 / 362860 RGDID:1563028 Length:662 Species:Rattus norvegicus


Alignment Length:352 Identity:69/352 - (19%)
Similarity:114/352 - (32%) Gaps:131/352 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 FTQDEIDFLRSHGNELCAKTWLGLWDPKRAVHQQEQRELMMDKYERKRYYLEPASPLKSLANAV- 137
            |...:|:|.:. |.|:.:|:..|.......:.|..|.||..:..:.:....|    |.|::.:| 
  Rat   203 FAHGQINFFKK-GAEMFSKSMDGFLSSVTDMVQSIQVELEAEADKMRVSQQE----LLSVSESVY 262

  Fly   138 --NLKSSAPATNHTQNGHQNGYASIHLTPPAAQRTSANGLQKVANSSSNSSGKTSSSISRPHYNH 200
              ::..:.|..|.... .:.||.::.                      |.:|..:::..|.::  
  Rat   263 TPDIDVATPQINRNLI-QKTGYLNLR----------------------NKTGLVTTTWERLYF-- 302

  Fly   201 QNNSQNNNHDAFGLGGGLSSLNSAGSTSTGALSDTSSCASNGFGADCD-----FVADFGSAN--- 257
                       |..||.| .....|:.:.|.:.|..:|:.  ...||:     |.....|..   
  Rat   303 -----------FTQGGNL-MCQPRGAVAGGLIQDLDNCSV--MAVDCEDRRYCFQISTPSGKPGI 353

  Fly   258 IFDATSARS-----------------TGSP-------------AVSSVSSVG------------- 279
            |..|.|.:.                 |.:|             ||:.::|.|             
  Rat   354 ILQAESRKEYEEWICAINNISRQIYLTDNPEAVAIKLNQTALQAVTPITSFGKKQESFYFSQNIK 418

  Fly   280 -SSNGYAKVQPIRAAHLQQQQQLQQQLHQQQLLNGNGHQGTENFADFDHAPI-YNAVAPPT-FND 341
             |..||.|:.|..||.:.:.::|..             .||         || ::.|.|.| |.|
  Rat   419 NSDTGYVKIVPKAAASIPETEELIA-------------PGT---------PIQFDIVLPATEFLD 461

  Fly   342 WISDWSRRGFH--DPFDDC-DDSPPGA 365
                 ..||..  :||.:. |||.|.|
  Rat   462 -----QNRGSRRINPFGETEDDSFPDA 483

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
drongoNP_001162848.1 ArfGap 15..126 CDD:279720 11/51 (22%)
Appl2NP_001102211.1 BAR_APPL2 20..234 CDD:153316 7/31 (23%)
BAR-PH_APPL 252..376 CDD:270067 26/166 (16%)
PTB_APPL 480..613 CDD:269980 2/4 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 643..662
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5347
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.