DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment drongo and Agap3

DIOPT Version :9

Sequence 1:NP_001162848.1 Gene:drongo / 33263 FlyBaseID:FBgn0020304 Length:673 Species:Drosophila melanogaster
Sequence 2:XP_006236000.1 Gene:Agap3 / 362300 RGDID:1310751 Length:1093 Species:Rattus norvegicus


Alignment Length:162 Identity:44/162 - (27%)
Similarity:73/162 - (45%) Gaps:23/162 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 NRQCFDCGQKGPTYVNMTIGSFVCTRCSGVLRGLTPPH--RVKSISMATFTQDEIDFLRSHGNEL 89
            |..|.||....|.:.::.:|:.:|..|||:.|.| ..|  ||:|:.:..:..:.:..:.:.||.|
  Rat   856 NSFCVDCEAPNPDWASLNLGALMCIECSGIHRHL-GAHLSRVRSLDLDDWPPELLAVMTAMGNAL 919

  Fly    90 CAKTWLGLWD----PKRAVHQQEQRELMMDKYERKRYYLE-PAS--PL-KSLANAV---NLK--- 140
            ....|.|..|    |.....::|:...:..|||:|.:... |:|  || :.|..||   :|:   
  Rat   920 ANSVWEGALDGYSKPGPEACREEKERWIRAKYEQKLFLAPLPSSDVPLGQQLLRAVVEDDLRLLV 984

  Fly   141 -----SSAPATNHTQNGHQNGYASIHLTPPAA 167
                 .|....|.|. |..:|..::||:...|
  Rat   985 MLLAHGSKEEVNETY-GDGDGRTALHLSSAMA 1015

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
drongoNP_001162848.1 ArfGap 15..126 CDD:279720 28/105 (27%)
Agap3XP_006236000.1 small_GTPase 309..474 CDD:197466
Centaurin_gamma 311..468 CDD:133303
PH_AGAP 584..827 CDD:241281
PH 587..>648 CDD:278594
ArfGap 855..960 CDD:279720 28/104 (27%)
Ank_2 971..1061 CDD:289560 12/46 (26%)
ANK 971..>1060 CDD:238125 12/46 (26%)
ANK repeat 971..1001 CDD:293786 7/30 (23%)
ANK repeat 1003..1034 CDD:293786 4/13 (31%)
ANK repeat 1036..1061 CDD:293786
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5347
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.