DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment drongo and CenG1A

DIOPT Version :9

Sequence 1:NP_001162848.1 Gene:drongo / 33263 FlyBaseID:FBgn0020304 Length:673 Species:Drosophila melanogaster
Sequence 2:NP_723849.1 Gene:CenG1A / 34803 FlyBaseID:FBgn0028509 Length:995 Species:Drosophila melanogaster


Alignment Length:286 Identity:59/286 - (20%)
Similarity:103/286 - (36%) Gaps:79/286 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LLALRELVASGTGSNRQCFDCGQKGPTYVNMTIGSFVCTRCSGVLRGL-TPPHRVKSISMATFTQ 76
            :||:|:.|.    .|..|.|||...|.:.::.:|..:|..||||.|.| :...:|:|:.:..:..
  Fly   704 MLAIRQRVP----GNGFCVDCGAPNPEWASLNLGVLMCIECSGVHRNLGSHISKVRSLGLDDWPS 764

  Fly    77 DEIDFLRSHGNELCAKTWLG----LWDPKRAVHQQEQRELMMDKYERKRYYLEP----------A 127
            ..:..:.:.||.|....|..    ...|.....::::...:..|||.|. :|.|          .
  Fly   765 PHLSVMLAIGNSLANSVWESNTRQRVKPTSQASREDKERWVRSKYEAKE-FLTPLGNGSSAHPSP 828

  Fly   128 SPLKSLANAV---NLKS------SAPA--TN---------------------------------- 147
            ||.:.|..||   ::||      :.|:  ||                                  
  Fly   829 SPGQQLIEAVIRADIKSIVSILANCPSEVTNANVSARDVRTPLLLACAIGNLAIAQLLIWNGANI 893

  Fly   148 -HTQNGHQNGYASIHLTPPAAQRTSANGLQKVANSSSNS-----SGKTSSSISRPHYNHQNNSQN 206
             ||.:   .|...:.....|....:|..::..|.:.:.:     :..|:..|..|.||.::.:. 
  Fly   894 KHTDH---EGRTCLAYARAAQSLATAKSIKAAAAAQAGTTIPAPAPPTNGGIPAPQYNVEDTTA- 954

  Fly   207 NNHDAFGLGGGLSSLNSAGSTSTGAL 232
                ...|..||....:|..|::|.|
  Fly   955 ----LVELLEGLGCPEAAPLTASGTL 976

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
drongoNP_001162848.1 ArfGap 15..126 CDD:279720 29/115 (25%)
CenG1ANP_723849.1 SelP_N <5..41 CDD:282453
Centaurin_gamma 143..300 CDD:133303
RAS 144..295 CDD:214541
PH_AGAP 451..686 CDD:241281
PH 454..>521 CDD:278594
ArfGap 702..818 CDD:279720 30/118 (25%)
ANK <834..907 CDD:238125 11/75 (15%)
ANK repeat 834..866 CDD:293786 8/31 (26%)
Ank_5 859..907 CDD:290568 4/50 (8%)
ANK repeat 868..897 CDD:293786 1/28 (4%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464136
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5347
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.