| Sequence 1: | NP_001162848.1 | Gene: | drongo / 33263 | FlyBaseID: | FBgn0020304 | Length: | 673 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_009295860.1 | Gene: | agap3 / 324332 | ZFINID: | ZDB-GENE-110927-1 | Length: | 1295 | Species: | Danio rerio |
| Alignment Length: | 246 | Identity: | 57/246 - (23%) |
|---|---|---|---|
| Similarity: | 95/246 - (38%) | Gaps: | 60/246 - (24%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 27 NRQCFDCGQKGPTYVNMTIGSFVCTRCSGVLRGL-TPPHRVKSISMATFTQDEIDFLRSHGNELC 90
Fly 91 AKTWLGLWD----PKRAVHQQEQRELMMDKYERKRYYLE-PAS--PL-KSLANAV---NLK---- 140
Fly 141 ----SSAPATNHTQNGHQNGYASIHL----------------------------TPPA-AQRTSA 172
Fly 173 NGLQKVAN-SSSNSSGKTSSSISRPHYNHQNNSQNNNHDAFGLGGGLSSLN 222 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| drongo | NP_001162848.1 | ArfGap | 15..126 | CDD:279720 | 26/104 (25%) |
| agap3 | XP_009295860.1 | small_GTPase | 507..672 | CDD:197466 | |
| Centaurin_gamma | 509..666 | CDD:133303 | |||
| PH_AGAP | 778..1025 | CDD:241281 | |||
| PH | 781..>845 | CDD:278594 | |||
| ArfGap | 1044..1155 | CDD:279720 | 26/100 (26%) | ||
| Ank_2 | 1190..1259 | CDD:289560 | 14/72 (19%) | ||
| ANK | 1199..>1259 | CDD:238125 | 11/62 (18%) | ||
| ANK repeat | 1201..1232 | CDD:293786 | 3/30 (10%) | ||
| ANK repeat | 1234..1259 | CDD:293786 | 8/27 (30%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_COG5347 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||