DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment drongo and acap3a

DIOPT Version :9

Sequence 1:NP_001162848.1 Gene:drongo / 33263 FlyBaseID:FBgn0020304 Length:673 Species:Drosophila melanogaster
Sequence 2:XP_021325699.1 Gene:acap3a / 322991 ZFINID:ZDB-GENE-030131-1711 Length:845 Species:Danio rerio


Alignment Length:272 Identity:53/272 - (19%)
Similarity:105/272 - (38%) Gaps:38/272 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 NRQCFDCGQKGPTYVNMTIGSFVCTRCSGVLRGL-TPPHRVKSISMATFTQDEIDFLRSHGNEL- 89
            |:||.||.|..|.:.::.:|..:|..|||:.|.| ....:|:|:::.::..:.:..:...||.: 
Zfish   415 NQQCCDCAQTEPRWASINLGVLLCIECSGIHRSLGVHCSKVRSLTLDSWEPELLKLMCELGNSII 479

  Fly    90 -------CAKTWLGLWDPKRAVHQQEQRELMMDKYERKRYYLEPASPLKSLANAVNLKSSAPATN 147
                   |.:.  ||..|.....:||:...:..||..|::       ||.:.....:.:....:.
Zfish   480 NHIYEGSCEEQ--GLKKPAPNSSRQEKEAWIKAKYVEKKF-------LKKMMTGEVVVNGGRKSE 535

  Fly   148 HTQNGHQNGYASIHLTPPAAQRTSANGLQKVANSSSNSSGKTSSSISRPHYNHQNNSQNNNHDAF 212
            ...|..:   ...|.:.....:|.....|...::|..:....::::.|..          ..::.
Zfish   536 RRWNSRK---CRRHNSATTVPKTHRKYRQDPGSASPATLSSATAALERKF----------RRESL 587

  Fly   213 GLGGGLSSLNSAGSTSTGALSDTSSCASNGFGADCDFVADFGSANIFDATSARSTGSPAVSSVSS 277
            .....|.:|.|...|.:|..|.|...:.:|.|...|     ||.::....|...:.:.....||.
Zfish   588 FCPDELDNLFSYFDTGSGPRSPTGLSSDSGLGGSTD-----GSTDVLVFESVVDSVTEEECEVSE 647

  Fly   278 VGSSNGYAKVQP 289
              .|:..|:::|
Zfish   648 --DSSNEAELEP 657

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
drongoNP_001162848.1 ArfGap 15..126 CDD:279720 27/107 (25%)
acap3aXP_021325699.1 BAR 16..215 CDD:325158
PH_ACAP 271..367 CDD:270070
ArfGap 403..520 CDD:307528 28/113 (25%)
ANK 674..790 CDD:238125
ANK repeat 674..700 CDD:293786
ANK repeat 702..735 CDD:293786
ANK repeat 737..762 CDD:293786
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5347
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.