Sequence 1: | NP_001162848.1 | Gene: | drongo / 33263 | FlyBaseID: | FBgn0020304 | Length: | 673 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_038939665.1 | Gene: | Agap1 / 316611 | RGDID: | 1309244 | Length: | 1428 | Species: | Rattus norvegicus |
Alignment Length: | 237 | Identity: | 54/237 - (22%) |
---|---|---|---|
Similarity: | 95/237 - (40%) | Gaps: | 63/237 - (26%) |
- Green bases have known domain annotations that are detailed below.
Fly 27 NRQCFDCGQKGPTYVNMTIGSFVCTRCSGVLRGL-TPPHRVKSISMATFTQDEIDFLRSHGNELC 90
Fly 91 AKTW----LGLWDPKRAVHQQEQRELMMDKYERKRYYLEP--------------ASPLKSLANAV 137
Fly 138 NL--KSSAPATNHTQNGHQNGYASIHLTPPAAQRTSA--------NGLQKVANSSSNSSGKTSSS 192
Fly 193 ISR--------------------------PHYNHQNNSQNNN 208 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
drongo | NP_001162848.1 | ArfGap | 15..126 | CDD:279720 | 31/103 (30%) |
Agap1 | XP_038939665.1 | Centaurin_gamma | 561..722 | CDD:133303 | |
PH_AGAP | 837..>911 | CDD:241281 | |||
PH-like | <1123..1163 | CDD:418428 | |||
ArfGap_AGAP2 | 1180..1288 | CDD:350078 | 27/95 (28%) | ||
ANK repeat | 1304..1332 | CDD:293786 | 4/27 (15%) | ||
Ank_2 | 1307..1397 | CDD:403870 | 16/96 (17%) | ||
ANK repeat | 1339..1370 | CDD:293786 | 6/36 (17%) | ||
ANK repeat | 1372..1397 | CDD:293786 | 3/24 (13%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5347 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.900 |