DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment drongo and Acap3

DIOPT Version :9

Sequence 1:NP_001162848.1 Gene:drongo / 33263 FlyBaseID:FBgn0020304 Length:673 Species:Drosophila melanogaster
Sequence 2:NP_001382677.1 Gene:Acap3 / 313772 RGDID:1310711 Length:833 Species:Rattus norvegicus


Alignment Length:324 Identity:74/324 - (22%)
Similarity:126/324 - (38%) Gaps:45/324 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 NRQCFDCGQKGPTYVNMTIGSFVCTRCSGVLRGL-TPPHRVKSISMATFTQDEIDFLRSHGNELC 90
            |.||.||||..|.:.::.:|..:|..|||:.|.| ....:|:|:::.::..:.:..:...||...
  Rat   415 NSQCGDCGQPDPRWASINLGVLLCIECSGIHRSLGVHCSKVRSLTLDSWEPELLKLMCELGNNTM 479

  Fly    91 AKTW------LGLWDPKRAVHQQEQRELMMDKYERKRYYLEPASPLKSLANAVNLKSSAPATNHT 149
            .:.:      .|:..|..:..:|::...:.|||..|::       |:.|       :|||.....
  Rat   480 NQIYEAQCEGPGIRKPTASSSRQDKEAWIKDKYVEKKF-------LRKL-------TSAPVREPP 530

  Fly   150 QNGHQNGYASIHLTPPAAQRTSANGLQKVANS--SSNSSGKTSSSISRPHY--NHQNNSQNNNHD 210
            :..........|.:|.|........|:.|..|  :.:|:|.......|...  ..:.:|..:..|
  Rat   531 RRWRAQKCQRPHSSPHAPTTRRKVRLEPVLPSVAALSSAGTMERKFRRDSLFCPDELDSLFSYFD 595

  Fly   211 AFGLGGGLSSLNSAGSTSTGALSDTSSCASNGFGADCDFVADFGSANIFDATSARSTGSPAVSSV 275
            |...|.|..||:|  .:..|..||.||          |.:| ||:.::.|:.:.........||.
  Rat   596 AGAAGAGPRSLSS--DSGLGGSSDGSS----------DVLA-FGTGSVVDSVTEEEGAESEESSS 647

  Fly   276 SSVGSSNGY--AKVQPIRAAHLQQQQQLQQQLHQQQLLNGNGHQGTENFADF---DHAPIYNAV 334
            ...|.:..:  |.|:.:....|..|....:.|  ..|.....|....|:||.   ...|:..||
  Rat   648 EVDGEAEAWSLADVRELHPGLLAHQAARTRDL--PALAAALAHGAEVNWADTADEGKTPLVQAV 709

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
drongoNP_001162848.1 ArfGap 15..126 CDD:279720 26/105 (25%)
Acap3NP_001382677.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5347
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.