DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment drongo and Smap2

DIOPT Version :9

Sequence 1:NP_001162848.1 Gene:drongo / 33263 FlyBaseID:FBgn0020304 Length:673 Species:Drosophila melanogaster
Sequence 2:NP_001094139.1 Gene:Smap2 / 298500 RGDID:1308418 Length:428 Species:Rattus norvegicus


Alignment Length:404 Identity:89/404 - (22%)
Similarity:145/404 - (35%) Gaps:114/404 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KQDDKYLLALRELVASGTGSNRQCFDCGQKGPTYVNMTIGSFVCTRCSGVLRGL-TPPHRVKSIS 70
            |..|:|...|..|:..  ..|:.|.||..|||.:.:..||.|:|.||:|:.|.| ....||||::
  Rat     7 KDVDRYQAVLANLLLE--EDNKFCADCQSKGPRWASWNIGVFICIRCAGIHRNLGVHISRVKSVN 69

  Fly    71 MATFTQDEIDFLRSHGNELCAKTWLGLWDP------KRAVHQQEQRELMMDKYERKRYYLEPASP 129
            :..:||::|..::..||....:    |::.      :|..........:.||||:|: |::.:..
  Rat    70 LDQWTQEQIQCMQEMGNGKANR----LYEAYLPETFRRPQIDPAVEGFIRDKYEKKK-YMDRSLD 129

  Fly   130 LKSLANAVNLK---SSAPATNHTQNGHQNGYASIHLTPPAAQRTSANGLQKVANSSSNSSGKTSS 191
            :..|....:.|   .|.||...            .:.|...::......::.|.....||.|:::
  Rat   130 INVLRKEKDDKWKRGSEPAPEK------------KMEPVVFEKVKMPQKKEDAQLPRKSSPKSAA 182

  Fly   192 SISRPHYNHQNNSQNNNHDAFGLGGGLSSLNSAGSTSTGALSDTSSCASNGFGADCDFVADFGSA 256
            .:.               |..||...:            |.|..:|..||....|.|.:|...|.
  Rat   183 PVM---------------DLLGLDAPV------------ACSIANSKTSNALEKDLDLLASVPSP 220

  Fly   257 NIFDATSARSTGS-PAVSSVSSV----------GSSNGYAKVQPIRAAHLQQQQQLQQQLHQQQL 310
            :   :.|.::.|| |...|..||          ||               :.::..::||.:..:
  Rat   221 S---SVSRKAVGSMPTAGSAGSVPENLNLFPEPGS---------------KSEETGKKQLSKDSI 267

  Fly   311 LNGNGHQGTENFAD-FDHAPIYNA--VAPPTFNDWISDWSRRGFHDPFDDCDDSPPGARPP---A 369
            |:..|.|..:..|. ...||...|  .|.|:|                       ||..||   .
  Rat   268 LSLYGSQTPQMPAQAMFMAPAQMAYPTAYPSF-----------------------PGVTPPNSIM 309

  Fly   370 PAPAPAQVPAVSSP 383
            .:..|..|..|:.|
  Rat   310 GSMMPPPVGMVAHP 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
drongoNP_001162848.1 ArfGap 15..126 CDD:279720 35/117 (30%)
Smap2NP_001094139.1 ArfGap_SMAP2 16..122 CDD:350083 33/111 (30%)
PBP1 <102..419 CDD:227507 58/303 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5347
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.