DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment drongo and Acap1

DIOPT Version :9

Sequence 1:NP_001162848.1 Gene:drongo / 33263 FlyBaseID:FBgn0020304 Length:673 Species:Drosophila melanogaster
Sequence 2:NP_001099266.2 Gene:Acap1 / 287443 RGDID:1305360 Length:740 Species:Rattus norvegicus


Alignment Length:256 Identity:54/256 - (21%)
Similarity:98/256 - (38%) Gaps:51/256 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 NRQCFDCGQKGPTYVNMTIGSFVCTRCSGVLRGLTPPH--RVKSISMATFTQDEIDFLRSHGNEL 89
            |.||.||.:..|.:.::.:|..:|.:|||:.|.| ..|  :|:|:::.::..:.:..:...||.:
  Rat   417 NAQCCDCKEPAPEWASINLGITLCIQCSGIHRSL-GVHFSKVRSLTLDSWEPELVKLMCELGNVV 480

  Fly    90 CAKTW------LGLWDPKRAVHQQEQRELMMDKYERKRYYLEPASPLKSLANAVNLKSSAPATNH 148
            ..:.:      :.:..|..:..:||:...:..||..|::       |..|...            
  Rat   481 INQIYEARVEAMAVKKPGPSCSRQEKEAWIHAKYVEKKF-------LTKLPEI------------ 526

  Fly   149 TQNGHQNGYASIHLTPPAAQRTSANGLQKVANSSSNSSGKTSSSISRPHYNHQN----------N 203
              .|.:.|.......||...:.|......:..|.|.|..:...|:      |..          .
  Rat   527 --RGRRGGRGPPRGHPPVPPKPSIRPQSGIVRSKSESPSEDIGSL------HPGALLFQAAGYPP 583

  Fly   204 SQNNNHDAFGLGGGLSSLNSAGSTSTGALSDTSSCASNGFGADCDFVADFGSANIFDATSA 264
            |.....||...|..::.:|:....:|..:..|   |:|...| |:|:...| ||:..|.||
  Rat   584 SLPTMADALAHGADVNWVNAGQGNATPLIRAT---AANSLLA-CEFLLQNG-ANVNQADSA 639

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
drongoNP_001162848.1 ArfGap 15..126 CDD:279720 24/106 (23%)
Acap1NP_001099266.2 BAR_ACAP1 18..217 CDD:153323
PH 266..360 CDD:278594
PH_ACAP 268..364 CDD:270070
ArfGap 406..519 CDD:279720 24/102 (24%)
ANK repeat 575..602 CDD:293786 4/26 (15%)
ANK <592..692 CDD:238125 15/53 (28%)
Ank_5 592..647 CDD:290568 15/53 (28%)
ANK repeat 606..637 CDD:293786 10/35 (29%)
Ank_5 626..680 CDD:290568 6/15 (40%)
ANK repeat 639..670 CDD:293786 1/1 (100%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5347
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.