DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment drongo and APPL1

DIOPT Version :9

Sequence 1:	NP_001162848.1	Gene:	drongo / 33263	FlyBaseID:	FBgn0020304	Length:	673	Species:	Drosophila melanogaster
Sequence 2:	NP_036228.1	Gene:	APPL1 / 26060	HGNCID:	24035	Length:	709	Species:	Homo sapiens

Alignment Length:	144	Identity:	32/144 - (22%)
Similarity:	58/144 - (40%)	Gaps:	18/144 - (12%)

- Green bases have known domain annotations that are detailed below.

  Fly   101 KRAVHQQEQRE------LMMDKYERKRYYLEPASPLKSLANAVNLKSSAPATNHTQNGHQNGYAS 159
            |.::.|.|.::      ..::...::.|..|......:..|...|::..|:.:..|.......|:
Human   351 KSSILQAESKKDHEEWICTINNISKQIYLSENPEETAARVNQSALEAVTPSPSFQQRHESLRPAA 415

  Fly   160 IHLTPPAAQRTSANGLQKVANSSSNSSGKTSSSISRPHYNHQNN-------SQNNNHDAFGLGGG 217
            ....||.| |||::|  .:.:.|:|.:..:..|:..|....|.:       .|.....|||.||.
Human   416 GQSRPPTA-RTSSSG--SLGSESTNLAALSLDSLVAPDTPIQFDIISPVCEDQPGQAKAFGQGGR 477

  Fly   218 LSSL--NSAGSTST 229
            .::.  .|.|||.:
Human   478 RTNPFGESGGSTKS 491

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
drongo	NP_001162848.1	ArfGap	15..126	CDD:279720	4/30 (13%)
APPL1	NP_036228.1	Required for RAB5A binding	1..428		16/77 (21%)
		BAR_APPL1	20..234	CDD:153315
		BAR-PH_APPL	252..376	CDD:270067	3/24 (13%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	397..434		10/39 (26%)
		F&H	403..414		1/10 (10%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	467..491		9/23 (39%)
		PTB_APPL	490..625	CDD:269980	0/2 (0%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	645..709
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG5347
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.900