DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment drongo and F07F6.7

DIOPT Version :9

Sequence 1:NP_001162848.1 Gene:drongo / 33263 FlyBaseID:FBgn0020304 Length:673 Species:Drosophila melanogaster
Sequence 2:NP_740988.1 Gene:F07F6.7 / 260090 WormBaseID:WBGene00017219 Length:265 Species:Caenorhabditis elegans


Alignment Length:188 Identity:44/188 - (23%)
Similarity:69/188 - (36%) Gaps:46/188 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 SFVCTRCSGVLRGLTPPHRVKSISM-----ATFTQDEIDFLRSHGNELCAKTWLGLWDPKRAVHQ 106
            |.|....:||.:.|...|:::.|:.     |.|.:   :.|.|..:.|                 
 Worm    99 SGVSNVATGVNKKLATDHKIREINRMLAEDAKFFE---ELLHSRNDLL----------------- 143

  Fly   107 QEQRELMMDKYERK--RYYLEPASPLKSL-------ANAVNLKSSAPATNHTQNGHQNG----YA 158
            .|.|..:.||...|  :.:.:..|.||:|       .....:|.:|.:..|..|....|    .|
 Worm   144 NEVRRFVEDKQSSKIFKNFDDVQSHLKTLFGVSLAGITGFGIKMAASSMGHLTNALMKGMLQSVA 208

  Fly   159 SIHLT-PPAAQRTSANGLQKVANSSSNSSGK---TSSSISRPHYNHQNNSQNNNHDAF 212
            :|.:. .......|||.|:.  .|||..:||   .|..:.|..:|...|..  |:||:
 Worm   209 AIGIVLDGVTLAMSANTLKN--GSSSELAGKIREASGKMERMRHNVVTNFL--NYDAW 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
drongoNP_001162848.1 ArfGap 15..126 CDD:279720 17/85 (20%)
F07F6.7NP_740988.1 ApoL 4..247 CDD:283187 38/169 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5347
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.