DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment drongo and ACAP2

DIOPT Version :9

Sequence 1:NP_001162848.1 Gene:drongo / 33263 FlyBaseID:FBgn0020304 Length:673 Species:Drosophila melanogaster
Sequence 2:XP_016861535.1 Gene:ACAP2 / 23527 HGNCID:16469 Length:848 Species:Homo sapiens


Alignment Length:347 Identity:68/347 - (19%)
Similarity:143/347 - (41%) Gaps:89/347 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 NRQCFDCGQKGPTYVNMTIGSFVCTRCSGVLRGLTPPH--RVKSISMATFTQDEIDFLRSHGNEL 89
            |..|.|||...|.:.::.:|..:|..|||:.|.| ..|  :|:|:::.|:..:.:..:...||::
Human   446 NASCCDCGLADPRWASINLGITLCIECSGIHRSL-GVHFSKVRSLTLDTWEPELLKLMCELGNDV 509

  Fly    90 CAKTW------LGLWDPKRAVHQQEQREL--------MMDKY-------ERKRYYLEPASPLKSL 133
            ..:.:      :|:..|:....|:::..:        .:|||       |:::.::..:|..|.|
Human   510 INRVYEANVEKMGIKKPQPGQRQEKEAYIRAKYVERKFVDKYSISLSPPEQQKKFVSKSSEEKRL 574

  Fly   134 ANA---------VNLKSSAPATNHTQNGHQNGYASIHL----------TPPAAQRTSANGLQKVA 179
            :.:         .:.:||..|.|..:...::.:....|          :...:.|::.:|:|:.:
Human   575 SISKFGPGDQVRASAQSSVIAVNSDEARRESLFCPDELDSLFSYFDTSSKLRSIRSNDSGIQQSS 639

  Fly   180 NSSSNS--SGKTSSSISRPHYNHQNNSQ--NNNHDAFGLGGGLSSLNSAGSTSTGALSDTSSCAS 240
            :....|  |..:::|:..|....|::|.  ::.|    |..||....::...:...:::..:   
Human   640 DDGRESLPSTVSANSLYEPEGERQDSSMFLDSKH----LNPGLQLYRASYEKNLPKMAEALA--- 697

  Fly   241 NGFGADCDFVADFGSANIFDATSARSTGSPAVSSVSSVGSS---------NGYAKVQPIRAAHLQ 296
              .|||.::           |.|..:..:|.:.:|  :|.|         || |.|.       |
Human   698 --HGADVNW-----------ANSEENKATPLIQAV--LGGSLVTCEFLLQNG-ANVN-------Q 739

  Fly   297 QQQQLQQQLHQQQLLNGNGHQG 318
            :..|.:..||...:|   ||.|
Human   740 RDVQGRGPLHHATVL---GHTG 758

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
drongoNP_001162848.1 ArfGap 15..126 CDD:279720 26/121 (21%)
ACAP2XP_016861535.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5347
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.