DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment drongo and Appl2

DIOPT Version :9

Sequence 1:NP_001162848.1 Gene:drongo / 33263 FlyBaseID:FBgn0020304 Length:673 Species:Drosophila melanogaster
Sequence 2:NP_660255.1 Gene:Appl2 / 216190 MGIID:2384914 Length:662 Species:Mus musculus


Alignment Length:402 Identity:69/402 - (17%)
Similarity:139/402 - (34%) Gaps:107/402 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 RKKQDDKYLLALRELVASGTGSNRQCFDCGQKGPTYVNMTIGSFVCTRCSGVLRGLTPPHRVKSI 69
            :||:::|   |..|:|.....:.|:           .:::...:.|     .|..|  .:|.::.
Mouse   152 KKKENEK---AKTEIVKEVAAARRK-----------QHLSSLQYYC-----ALNAL--QYRKRAA 195

  Fly    70 SMAT---FTQDEIDFLRSHGNELCAKTWLGLWDPKRAVHQQEQRELMMDKYERKRYYLEPASPLK 131
            .|..   |...:|:|.: .|.|:.:|:..|.....:.:.|..|.||..:..:.:....|    |.
Mouse   196 MMEPLIGFAHGQINFFK-RGAEMFSKSMDGFLSSVKDMVQSIQVELEAEADKMRVSQQE----LL 255

  Fly   132 SLANAVNLKSSAPATNHTQNG--HQNGYASIHLTPPAAQRTSANGLQKVANSSSNSSGKTSSSIS 194
            |::.:|.......||......  .:.||.::.                      |.:|..:::..
Mouse   256 SVSESVYTPDIDVATAQINRNLIQKTGYLNLR----------------------NKTGLVTTTWE 298

  Fly   195 RPHYNHQNNSQNNNHDAFGLGGGLSSLNSAGSTSTGALSDTSSCASNGFGADCD-------FVAD 252
            |.::             |..||.| .....|:.:.|.:.|..:|:.  ...||:       ....
Mouse   299 RLYF-------------FTQGGNL-MCQPRGAVAGGLIQDLDNCSV--MAVDCEDRRYCFQISTP 347

  Fly   253 FGSANIFDATSARSTGSPAVSSVSSVG----------------SSNGYAKVQPIRAAHLQQQQQL 301
            .|...|.....:|......:.:|:::.                :......|.||.:...:|:...
Mouse   348 SGKPGIILQAESRKEYEEWICAVNNISRQIYLTDNPEAVAIKLNQTALQAVTPITSFGKKQESSC 412

  Fly   302 -QQQLHQQQLLNGN-GHQGTENFADFDH-----API-YNAVAPPTFNDWISDWSRRGFH-DPFDD 357
             .|.:....:.:.| ..:.|.:..:.:.     .|| ::.|.|.|  ::: |.:|.|.. :||.:
Mouse   413 SSQNIKNSDIEDDNIVPKATASIPETEELIAPGTPIQFDIVLPAT--EFL-DQNRGGRRTNPFGE 474

  Fly   358 CDDSPPGARPPA 369
            .:|   |:.|.|
Mouse   475 TED---GSFPEA 483

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
drongoNP_001162848.1 ArfGap 15..126 CDD:279720 20/113 (18%)
Appl2NP_660255.1 BAR_APPL2 20..234 CDD:153316 19/103 (18%)
BAR-PH_APPL 252..376 CDD:270067 25/165 (15%)
PH 278..378 CDD:278594 19/137 (14%)
PH domain 278..376 19/135 (14%)
PTB_APPL 480..613 CDD:269980 2/4 (50%)
PTB domain 491..607
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 642..662
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5347
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.