DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment drongo and Arap2

DIOPT Version :9

Sequence 1:	NP_001162848.1	Gene:	drongo / 33263	FlyBaseID:	FBgn0020304	Length:	673	Species:	Drosophila melanogaster
Sequence 2:	NP_848494.2	Gene:	Arap2 / 212285	MGIID:	2684416	Length:	1703	Species:	Mus musculus

Alignment Length:	132	Identity:	32/132 - (24%)
Similarity:	59/132 - (44%)	Gaps:	25/132 - (18%)

- Green bases have known domain annotations that are detailed below.

  Fly     5 RKKQDDKYLLALRELVASGTG------------SNRQCFDCGQKGPTYVNMTIGSFVCTRCSGVL 57
            |:||:  ::.|:::.:|....            |||.|.||....|.:.::.:...:|.:|:|..
Mouse   663 REKQE--WIEAVQQSIAETLSDYEVAEKIWFNESNRSCADCKAPDPDWASINLCVVICKKCAGQH 725

  Fly    58 RGLTP-PHRVKSISM--ATFTQDEIDFLRSHGNELCAKTWLGLWDPKRAVHQQEQRELMMDKYER 119
            |.|.| ..:|:|:.|  :.::.:.|:.....||:.....|.|        :.|:..||.:|....
Mouse   726 RSLGPKDSKVRSLKMDASIWSNELIELFIVIGNKRANDFWAG--------NLQKDEELQVDSPVE 782

  Fly   120 KR 121
            ||
Mouse   783 KR 784

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
drongo	NP_001162848.1	ArfGap	15..126	CDD:279720	29/122 (24%)
Arap2	NP_848494.2	SAM_Arap1,2,3	6..68	CDD:188889
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	84..132
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	191..232
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	286..319
		PH1_ARAP	482..573	CDD:270073
		PH2_ARAP	583..673	CDD:270074	4/11 (36%)
		ArfGap_ARAP2	678..798	CDD:350081	27/115 (23%)
		PH3_ARAP	890..1000	CDD:270076
		PH-like	1013..1108	CDD:388408
		RhoGAP_ARAP	1112..1291	CDD:239850
		RA_ARAP2	1323..1420	CDD:340747
		PH-like	1426..1537	CDD:388408
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1633..1670
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1684..1703
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG5347
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	2	1.810