Sequence 1: | NP_001162848.1 | Gene: | drongo / 33263 | FlyBaseID: | FBgn0020304 | Length: | 673 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_495029.2 | Gene: | F07F6.4 / 173927 | WormBaseID: | WBGene00017217 | Length: | 529 | Species: | Caenorhabditis elegans |
Alignment Length: | 437 | Identity: | 83/437 - (18%) |
---|---|---|---|
Similarity: | 133/437 - (30%) | Gaps: | 171/437 - (39%) |
- Green bases have known domain annotations that are detailed below.
Fly 15 ALRELVASGTGSNRQCFDCGQKGPTYVNMTIGSFVCTRCSGVLRGLTPPHRVKSISMATFTQDEI 79
Fly 80 D---------------------FLRSHGNELCAKTWLGLWDPKRAVH----------QQEQR--- 110
Fly 111 -ELMMDKY--------ERKRYYLEPASPLKSLANAVNLKSSAPATNHTQNGHQNGYASIHLTPPA 166
Fly 167 AQRTSAN---------------------GLQKV-------ANSSSNSSGKTSSSI--SRPHYNHQ 201
Fly 202 NNSQNNNHDA--------------------------------------FGLG------------G 216
Fly 217 GLSSL------------------------NSAGSTSTGALSD------TSSCASNGFGADCDFVA 251
Fly 252 DFGSANIFDATSARSTGSPAVSSVSSVGSSNGYAKVQPIRAAHLQQQ 298 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
drongo | NP_001162848.1 | ArfGap | 15..126 | CDD:279720 | 34/153 (22%) |
F07F6.4 | NP_495029.2 | ArfGap | 16..129 | CDD:214518 | 28/124 (23%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5347 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |