DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment drongo and Acap3

DIOPT Version :9

Sequence 1:NP_001162848.1 Gene:drongo / 33263 FlyBaseID:FBgn0020304 Length:673 Species:Drosophila melanogaster
Sequence 2:NP_997106.1 Gene:Acap3 / 140500 MGIID:2153589 Length:833 Species:Mus musculus


Alignment Length:327 Identity:77/327 - (23%)
Similarity:129/327 - (39%) Gaps:51/327 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 NRQCFDCGQKGPTYVNMTIGSFVCTRCSGVLRGL-TPPHRVKSISMATFTQDEIDFLRSHGNELC 90
            |.||.||||..|.:.::.:|..:|..|||:.|.| ....:|:|:::.::..:.:..:...||...
Mouse   415 NSQCGDCGQPDPRWASINLGVLLCIECSGIHRSLGVHCSKVRSLTLDSWEPELLKLMCELGNSTV 479

  Fly    91 AKTW------LGLWDPKRAVHQQEQRELMMDKYERKRYYLEPASPLKSLANAVNLKSSAPATNHT 149
            .:.:      .|:..|..:..:|::...:.|||..|::       |:.|       :||||....
Mouse   480 NQIYEAQCEGPGVRKPTASSSRQDKEAWIKDKYVEKKF-------LRKL-------TSAPAREPP 530

  Fly   150 QNGHQNGYASIHLTPPAAQRTSANGLQKVANS-SSNSSGKT------SSSISRPHYNHQNNSQNN 207
            :..........|.:|.|........|:.|..| ::.||..|      ..|:..|   .:.:|..:
Mouse   531 RRWRAQKCQRPHSSPHAPTTRRKVRLEPVLPSVAALSSAATMERKFRRDSLFCP---DELDSLFS 592

  Fly   208 NHDAFGLGGGLSSLNSAGSTSTGALSDTSSCASNGFGADCDFVADFGSANIFDATSARSTGSPAV 272
            ..||...|.|..||:|  .:..|..||.||          |.:| ||:.::.|:.:.........
Mouse   593 YFDAGAAGAGPRSLSS--DSGLGGSSDGSS----------DVLA-FGTGSVVDSVTEEEGAESEE 644

  Fly   273 SSVSSVGSSNGY--AKVQPIRAAHLQQQQQLQQQLHQQQLLNGNGHQGTENFADF---DHAPIYN 332
            ||....|.:..:  |.|:.:....|..|....:.|  ..|.....|....|:||.   ...|:..
Mouse   645 SSSEVDGEAEAWSLADVRELHPGLLAHQAARTRDL--PALAAALAHGAEVNWADAADEGKTPLVQ 707

  Fly   333 AV 334
            ||
Mouse   708 AV 709

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
drongoNP_001162848.1 ArfGap 15..126 CDD:279720 26/105 (25%)
Acap3NP_997106.1 BAR_ACAP3 16..215 CDD:153321
PH 269..363 CDD:278594
PH_ACAP 271..367 CDD:270070
ArfGap 403..521 CDD:279720 27/112 (24%)
ANK 671..786 CDD:238125 10/41 (24%)
Ank_2 671..764 CDD:289560 10/41 (24%)
ANK repeat 700..731 CDD:293786 3/10 (30%)
ANK repeat 733..764 CDD:293786
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5347
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.