DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment drongo and AgaP_AGAP007379

DIOPT Version :9

Sequence 1:NP_001162848.1 Gene:drongo / 33263 FlyBaseID:FBgn0020304 Length:673 Species:Drosophila melanogaster
Sequence 2:XP_308452.4 Gene:AgaP_AGAP007379 / 1269802 VectorBaseID:AGAP007379 Length:383 Species:Anopheles gambiae


Alignment Length:128 Identity:29/128 - (22%)
Similarity:53/128 - (41%) Gaps:30/128 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 QDDKYLLALRELVASGTGSNRQCFDCGQKGPTYVNMTIGSFVCTRCSGVLRGLTPPH--RVKSIS 70
            |::|.|..|.:     ...|..|.||..|...:.:..||.|:||||..|.|.: ..|  :||.:.
Mosquito     4 QNEKILHRLLQ-----QDGNSICADCDSKNLEWASYNIGIFLCTRCCAVHRSM-GAHISKVKHLK 62

  Fly    71 MATFTQDEIDFLRSHGNE-----------LCAKTWLGLWDPKRAVHQQEQRELMMDKYERKRY 122
            :..:...:|..:...||:           .|.:.      ||     :...:::::::.|.:|
Mosquito    63 LDKWEDSQIQRMIDVGNKSARLKYENRVPACYRR------PK-----ENDPQILIEQWIRAKY 114

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
drongoNP_001162848.1 ArfGap 15..126 CDD:279720 26/121 (21%)
AgaP_AGAP007379XP_308452.4 ArfGap 6..123 CDD:279720 28/126 (22%)
PH1_ADAP 130..237 CDD:270072
PH 132..225 CDD:278594
PH2_ADAP 251..354 CDD:241282
PH 253..353 CDD:278594
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5347
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.