DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment drongo and AGAP4

DIOPT Version :9

Sequence 1:NP_001162848.1 Gene:drongo / 33263 FlyBaseID:FBgn0020304 Length:673 Species:Drosophila melanogaster
Sequence 2:NP_001263272.2 Gene:AGAP4 / 119016 HGNCID:23459 Length:686 Species:Homo sapiens


Alignment Length:205 Identity:50/205 - (24%)
Similarity:81/205 - (39%) Gaps:36/205 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 NRQCFDCGQKGPTYVNMTIGSFVCTRCSGVLRGL-TPPHRVKSISMATFTQDEIDFLRSHGNELC 90
            |..|.||..:.|.:.::.:|..:|..|||:.|.| |...||:|:.:..:..:....:.|.||:|.
Human   476 NAHCVDCETQNPKWASLNLGVLMCIECSGIHRSLGTRLSRVRSLELDDWPVELRKVMSSIGNDLA 540

  Fly    91 AKTW----LGLWDPKRAVHQQEQRELMMDKYERKRYYLEP--------------ASPLKSLANAV 137
            ...|    .|...|.....::|:...:..|||.| .:|.|              |:..:.|..|:
Human   541 NSIWEGSSQGQTKPSEKSTREEKERWIRSKYEEK-LFLAPLPCTELSLGQQLLRATADEDLQTAI 604

  Fly   138 NL--KSSAPATNHTQNGHQNGYASIHL-----TPPAAQRTSANGLQKVANSSSNSSGKTSSSISR 195
            .|  ..|....|.| .|..:|..::||     ....||.....|:..:|..:..::..|      
Human   605 LLLAHGSREEVNET-CGEGDGCTALHLACRKGNVVLAQLLIWYGVDVMARDAHGNTALT------ 662

  Fly   196 PHYNHQNNSQ 205
              |..|.:||
Human   663 --YARQASSQ 670

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
drongoNP_001162848.1 ArfGap 15..126 CDD:279720 29/103 (28%)
AGAP4NP_001263272.2 PH_AGAP 280..447 CDD:241281
PH 283..442 CDD:278594
ArfGap 466..580 CDD:279720 29/104 (28%)
Ank_2 591..681 CDD:289560 20/89 (22%)
ANK repeat 591..621 CDD:293786 7/30 (23%)
ANK <594..677 CDD:238125 20/86 (23%)
ANK repeat 623..654 CDD:293786 7/30 (23%)
ANK repeat 656..681 CDD:293786 5/23 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5347
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.