Sequence 1: | NP_001162848.1 | Gene: | drongo / 33263 | FlyBaseID: | FBgn0020304 | Length: | 673 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001263272.2 | Gene: | AGAP4 / 119016 | HGNCID: | 23459 | Length: | 686 | Species: | Homo sapiens |
Alignment Length: | 205 | Identity: | 50/205 - (24%) |
---|---|---|---|
Similarity: | 81/205 - (39%) | Gaps: | 36/205 - (17%) |
- Green bases have known domain annotations that are detailed below.
Fly 27 NRQCFDCGQKGPTYVNMTIGSFVCTRCSGVLRGL-TPPHRVKSISMATFTQDEIDFLRSHGNELC 90
Fly 91 AKTW----LGLWDPKRAVHQQEQRELMMDKYERKRYYLEP--------------ASPLKSLANAV 137
Fly 138 NL--KSSAPATNHTQNGHQNGYASIHL-----TPPAAQRTSANGLQKVANSSSNSSGKTSSSISR 195
Fly 196 PHYNHQNNSQ 205 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
drongo | NP_001162848.1 | ArfGap | 15..126 | CDD:279720 | 29/103 (28%) |
AGAP4 | NP_001263272.2 | PH_AGAP | 280..447 | CDD:241281 | |
PH | 283..442 | CDD:278594 | |||
ArfGap | 466..580 | CDD:279720 | 29/104 (28%) | ||
Ank_2 | 591..681 | CDD:289560 | 20/89 (22%) | ||
ANK repeat | 591..621 | CDD:293786 | 7/30 (23%) | ||
ANK | <594..677 | CDD:238125 | 20/86 (23%) | ||
ANK repeat | 623..654 | CDD:293786 | 7/30 (23%) | ||
ANK repeat | 656..681 | CDD:293786 | 5/23 (22%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5347 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |