Sequence 1: | NP_001162848.1 | Gene: | drongo / 33263 | FlyBaseID: | FBgn0020304 | Length: | 673 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_006712302.2 | Gene: | AGAP1 / 116987 | HGNCID: | 16922 | Length: | 1151 | Species: | Homo sapiens |
Alignment Length: | 233 | Identity: | 54/233 - (23%) |
---|---|---|---|
Similarity: | 93/233 - (39%) | Gaps: | 55/233 - (23%) |
- Green bases have known domain annotations that are detailed below.
Fly 27 NRQCFDCGQKGPTYVNMTIGSFVCTRCSGVLRGL-TPPHRVKSISMATFTQDEIDFLRSHGNELC 90
Fly 91 AKTW----LGLWDPKRAVHQQEQRELMMDKYERKRY-------------YLEPASPLKSLANAVN 138
Fly 139 L--KSSAPATNHTQNGHQNGYASIHL-----TPPAAQRTSANGLQKVANSSSNSSGKTSSSISR- 195
Fly 196 -------------------------PHYNHQNNSQNNN 208 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
drongo | NP_001162848.1 | ArfGap | 15..126 | CDD:279720 | 31/116 (27%) |
AGAP1 | XP_006712302.2 | Centaurin_gamma | 337..498 | CDD:133303 | |
RAS | 338..504 | CDD:214541 | |||
PH_AGAP | 613..886 | CDD:241281 | |||
PH | 616..>680 | CDD:278594 | |||
PH | <830..881 | CDD:278594 | |||
ArfGap | 905..1019 | CDD:279720 | 30/103 (29%) | ||
Ank_2 | 1030..1120 | CDD:289560 | 19/93 (20%) | ||
ANK | 1030..>1119 | CDD:238125 | 19/92 (21%) | ||
ANK repeat | 1062..1093 | CDD:293786 | 7/33 (21%) | ||
ANK repeat | 1095..1120 | CDD:293786 | 3/24 (13%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5347 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |