DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment drongo and AGAP1

DIOPT Version :9

Sequence 1:NP_001162848.1 Gene:drongo / 33263 FlyBaseID:FBgn0020304 Length:673 Species:Drosophila melanogaster
Sequence 2:XP_006712302.2 Gene:AGAP1 / 116987 HGNCID:16922 Length:1151 Species:Homo sapiens


Alignment Length:233 Identity:54/233 - (23%)
Similarity:93/233 - (39%) Gaps:55/233 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 NRQCFDCGQKGPTYVNMTIGSFVCTRCSGVLRGL-TPPHRVKSISMATFTQDEIDFLRSHGNELC 90
            |..|.||..:.|.:.::.:|:.:|..|||:.|.| |...||:|:.:..:..:.|..:.|.||||.
Human   915 NSHCVDCETQNPNWASLNLGALMCIECSGIHRNLGTHLSRVRSLDLDDWPVELIKVMSSIGNELA 979

  Fly    91 AKTW----LGLWDPKRAVHQQEQRELMMDKYERKRY-------------YLEPASPLKSLANAVN 138
            ...|    .|...|.....::|:...:..|||:|.:             :|..|:..:.|..|:.
Human   980 NSVWEESSQGRTKPSVDSTREEKERWIRAKYEQKLFLAPLPCTELSLGQHLLRATADEDLRTAIL 1044

  Fly   139 L--KSSAPATNHTQNGHQNGYASIHL-----TPPAAQRTSANGLQKVANSSSNSSGKTSSSISR- 195
            |  ..|....|.| .|..:|..::||     ....||.....|:...|.   ::.|.|:.:.:| 
Human  1045 LLAHGSRDEVNET-CGEGDGRTALHLACRKGNVVLAQLLIWYGVDVTAR---DAHGNTALAYARQ 1105

  Fly   196 -------------------------PHYNHQNNSQNNN 208
                                     |:.:.:||::||:
Human  1106 ASSQECIDVLLQYGCPDERFVLMATPNLSRRNNNRNNS 1143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
drongoNP_001162848.1 ArfGap 15..126 CDD:279720 31/116 (27%)
AGAP1XP_006712302.2 Centaurin_gamma 337..498 CDD:133303
RAS 338..504 CDD:214541
PH_AGAP 613..886 CDD:241281
PH 616..>680 CDD:278594
PH <830..881 CDD:278594
ArfGap 905..1019 CDD:279720 30/103 (29%)
Ank_2 1030..1120 CDD:289560 19/93 (20%)
ANK 1030..>1119 CDD:238125 19/92 (21%)
ANK repeat 1062..1093 CDD:293786 7/33 (21%)
ANK repeat 1095..1120 CDD:293786 3/24 (13%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5347
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.