DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment drongo and ACAP3

DIOPT Version :9

Sequence 1:NP_001162848.1 Gene:drongo / 33263 FlyBaseID:FBgn0020304 Length:673 Species:Drosophila melanogaster
Sequence 2:XP_011538908.1 Gene:ACAP3 / 116983 HGNCID:16754 Length:844 Species:Homo sapiens


Alignment Length:335 Identity:77/335 - (22%)
Similarity:130/335 - (38%) Gaps:65/335 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 NRQCFDCGQKGPTYVNMTIGSFVCTRCSGVLRGL-TPPHRVKSISMATFTQDEIDFLRSHGNELC 90
            |.||.||||..|.:.::.:|..:|..|||:.|.| ....:|:|:::.::..:.:..:...||...
Human   425 NSQCGDCGQPDPRWASINLGVLLCIECSGIHRSLGVHCSKVRSLTLDSWEPELLKLMCELGNSAV 489

  Fly    91 AKTW------LGLWDPKRAVHQQEQRELMMDKYERKRYYLEPASPLKSLANAVNLKSSAPATNHT 149
            .:.:      .|...|..:..:|::...:.|||..|::..:  :|:            |||....
Human   490 NQIYEAQCEGAGSRKPTASSSRQDKEAWIKDKYVEKKFLRK--APM------------APALEAP 540

  Fly   150 QNGHQNGYASIHLTP--PAAQRTSANGLQKV--ANSSSNSSGKTSSSISRPHY--NHQNNSQNNN 208
            :..........|.:|  |.|:|...  |:.|  ..::.:|.|.......|...  ..:.:|..:.
Human   541 RRWRVQKCLRPHSSPRAPTARRKVR--LEPVLPCVAALSSVGTLDRKFRRDSLFCPDELDSLFSY 603

  Fly   209 HDAFGLGGGLSSLNSAGSTSTGALSDTSSCASNGFGADCDFVADFGSANIFDATSARSTGSPAVS 273
            .||...|.|..||:|  .:..|..||.||          |.:| |||.::.|:.:.........|
Human   604 FDAGAAGAGPRSLSS--DSGLGGSSDGSS----------DVLA-FGSGSVVDSVTEEEGAESEES 655

  Fly   274 SVSSVGSSN----GYAKVQPI-------RAAHLQQQQQLQQQLHQQQLLNGNGHQGTENFADFD- 326
            |..:.|.:.    |.|.|:.:       |||..:....|...|         .|....|:||.: 
Human   656 SGEADGDTEAEAWGLADVRELHPGLLAHRAARARDLPALAAAL---------AHGAEVNWADAED 711

  Fly   327 --HAPIYNAV 334
              ..|:..||
Human   712 EGKTPLVQAV 721

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
drongoNP_001162848.1 ArfGap 15..126 CDD:279720 26/105 (25%)
ACAP3XP_011538908.1 BAR 16..225 CDD:299863
PH 279..373 CDD:278594
PH_ACAP 281..377 CDD:270070
ArfGap 413..531 CDD:279720 26/107 (24%)
ANK 711..>798 CDD:238125 3/11 (27%)
ANK repeat 712..743 CDD:293786 3/10 (30%)
Ank_4 715..766 CDD:290365 3/7 (43%)
ANK repeat 745..776 CDD:293786
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5347
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.