DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment drongo and zgc:162872

DIOPT Version :9

Sequence 1:NP_001162848.1 Gene:drongo / 33263 FlyBaseID:FBgn0020304 Length:673 Species:Drosophila melanogaster
Sequence 2:XP_009290262.1 Gene:zgc:162872 / 100004931 ZFINID:ZDB-GENE-081022-1 Length:701 Species:Danio rerio


Alignment Length:362 Identity:70/362 - (19%)
Similarity:121/362 - (33%) Gaps:108/362 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 SGTGSNRQCFDCGQKGPTYVNMTIGSFVCTRCSGVLRGL-TPPHRVKSISMATFTQDEIDFLRSH 85
            ||.| |:.|.|||:..|.:.::.:|..:|..|||:.|.| ....:|:|:::.::..:::..|...
Zfish   396 SGRG-NQHCCDCGEAEPRWASVNLGITMCIECSGIHRSLGVHLSKVRSLTLDSWEPEQLKLLCVL 459

  Fly    86 GNELCAKTWL-----GLWDPKRAVHQQEQRELMMDKYERKRYYLEPASPLKSLANAVNLKSSAPA 145
            |||:....:.     ||..|.....:|::.:.:..||..||                        
Zfish   460 GNEVINGIYEREAADGLQKPSAGSPRQDKEQWIRSKYVEKR------------------------ 500

  Fly   146 TNHTQNGHQNGYASIHLTPPAAQRTSANGLQKV--ANSSSNSSGKTSSSISRPHYNHQNNSQNNN 208
                       :.:.||..|.|........:::  |:.|.:......|.......|..||.|...
Zfish   501 -----------FVARHLDGPDADALKLRARKRLYSASVSGDLVAMAESLAEGAEINWNNNEQEGR 554

  Fly   209 HDAFG--LGGGLSSLNSAGSTSTGALSDTSSCASNGFGADCDFVADFGSANIFDATSARSTGSPA 271
            ....|  :||.|.:                          |:|:...| ||:   ......|..|
Zfish   555 TALIGSAIGGSLLA--------------------------CEFLLQNG-ANV---NHRDQRGQGA 589

  Fly   272 VSSVSSVG-----------SSNGYAKVQ--------PIRAAHLQQQQQLQQQLHQQQLLNGNGHQ 317
            :.:.::.|           .:|.||..:        .|..||......|:.....:::.:..|..
Zfish   590 LHAAATYGHTGQVCLLLKRGANQYAADEKGNDPLSIAIETAHADIVTLLRMARMNEEMRDSEGFF 654

  Fly   318 GTENFADFDHAPIYNAVAPPTFNDWISDWSRRGFHDP 354
            |:....:             ||.|...|:|....|||
Zfish   655 GSVGDDE-------------TFQDIFRDFSNMASHDP 678

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
drongoNP_001162848.1 ArfGap 15..126 CDD:279720 30/109 (28%)
zgc:162872XP_009290262.1 BAR_ACAPs 18..217 CDD:153287
PH 265..357 CDD:278594
PH_ACAP 266..362 CDD:270070
ArfGap 399..504 CDD:279720 28/140 (20%)
Ank_2 <508..583 CDD:289560 18/104 (17%)
ANK 522..638 CDD:238125 25/145 (17%)
ANK repeat 552..583 CDD:293786 9/60 (15%)
Ank_2 557..649 CDD:289560 19/121 (16%)
ANK repeat 585..616 CDD:293786 6/30 (20%)
ANK repeat 618..649 CDD:293786 4/30 (13%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5347
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.