DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dock and SLA2

DIOPT Version :9

Sequence 1:NP_001259845.1 Gene:dock / 33262 FlyBaseID:FBgn0010583 Length:548 Species:Drosophila melanogaster
Sequence 2:XP_016883587.1 Gene:SLA2 / 84174 HGNCID:17329 Length:288 Species:Homo sapiens


Alignment Length:213 Identity:54/213 - (25%)
Similarity:76/213 - (35%) Gaps:78/213 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   322 AENVLDIVVALYSFTSNNDQELSFEKGDRLEIVDRPASDPDWYKARNNQGQVGLVPRNYLQELND 386
            ||......|||.||.:....|||...|:.|.||   :.|.||:              ..|.|:  
Human    30 AERSKATAVALGSFPAGGPAELSLRLGEPLTIV---SEDGDWW--------------TVLSEV-- 75

  Fly   387 YLATPYRNASASAGNGNGGGSNGGAGGGGGNDSMERRNEGNKPAAQSSGQPIERPNL----AGKS 447
                                                           ||:....|::    ....
Human    76 -----------------------------------------------SGREYNIPSVHVAKVSHG 93

  Fly   448 WYYGAITRSQCDTVLNGHGHDGD-FLIRDSETNMGDYSVS--LKAPG---RNKHFRVHVEQN--M 504
            |.|..::|.:.:.:|...|:.|. ||||:|:|..|.||:|  |..|.   |.:|:|:|...|  :
Human    94 WLYEGLSREKAEELLLLPGNPGGAFLIRESQTRRGSYSLSVRLSRPASWDRIRHYRIHCLDNGWL 158

  Fly   505 YCIGQRKFHSLDQLVDHY 522
            |...:..|.||..|||||
Human   159 YISPRLTFPSLQALVDHY 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dockNP_001259845.1 SH3_Nck_1 154..204 CDD:212699
SH3_Nck_2 256..308 CDD:212700
SH3_Nck_3 328..383 CDD:212701 16/54 (30%)
SH2_Nck_family 446..538 CDD:198196 32/85 (38%)
SLA2XP_016883587.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165148272
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.