Sequence 1: | NP_001259845.1 | Gene: | dock / 33262 | FlyBaseID: | FBgn0010583 | Length: | 548 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001030161.1 | Gene: | sla1a / 571922 | ZFINID: | ZDB-GENE-050904-3 | Length: | 271 | Species: | Danio rerio |
Alignment Length: | 201 | Identity: | 43/201 - (21%) |
---|---|---|---|
Similarity: | 78/201 - (38%) | Gaps: | 70/201 - (34%) |
- Green bases have known domain annotations that are detailed below.
Fly 327 DIVVALYSFTSNNDQELSFEKGDRLEIVDRPASDPDWYKARNNQ-GQVGLVPRNYLQELNDYLAT 390
Fly 391 PYRNASASAGNGNGGGSNGGAGGGGGNDSMERRNEGNKPAAQSSGQPIERPNLAGKSWYYGAITR 455
Fly 456 SQCDTVLNGHGHD-GDFLIRDSETNMGDYSVSLKAPGRN-KHFRV-HVEQNMYCIGQR-KFHSLD 516
Fly 517 QLVDHY 522 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
dock | NP_001259845.1 | SH3_Nck_1 | 154..204 | CDD:212699 | |
SH3_Nck_2 | 256..308 | CDD:212700 | |||
SH3_Nck_3 | 328..383 | CDD:212701 | 16/55 (29%) | ||
SH2_Nck_family | 446..538 | CDD:198196 | 25/81 (31%) | ||
sla1a | NP_001030161.1 | SH3_SLAP | 26..80 | CDD:212943 | 16/56 (29%) |
SH2_SLAP | 73..170 | CDD:198207 | 28/150 (19%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C170582185 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |