DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dock and sla2b

DIOPT Version :9

Sequence 1:NP_001259845.1 Gene:dock / 33262 FlyBaseID:FBgn0010583 Length:548 Species:Drosophila melanogaster
Sequence 2:XP_017209080.1 Gene:sla2b / 568515 ZFINID:ZDB-GENE-080204-98 Length:265 Species:Danio rerio


Alignment Length:269 Identity:53/269 - (19%)
Similarity:101/269 - (37%) Gaps:86/269 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   291 RGQSGNSVGWFPSNYTTEDCDNDGEIHTYAMAENVLDIVVALYSFTSNNDQELSFEKGDRLEIVD 355
            ||.:.::|     ...||  |::|.:    ..|::..::|:||.:.|....:.:...|:||.|: 
Zfish    10 RGSNAHAV-----LLDTE--DSNGPL----TMESIRYVLVSLYDYPSRGPGDCAIRVGERLNIL- 62

  Fly   356 RPASDPDWYKARNN-QGQVGLVPRNYLQELNDYLATPYRNASASAGNGNGGGSNGGAGGGGGNDS 419
              :.:.:|:|..:: .|....:|.||..:|.:                                 
Zfish    63 --SDEGEWFKVSSSATGNESYIPSNYTAKLYN--------------------------------- 92

  Fly   420 MERRNEGNKPAAQSSGQPIERPNLAGKSWYYGAITRSQCDTVLN-GHGHDGDFLIRDSETNMGDY 483
                                       .|.:..:::.:.:.:|. .|...|.||||:|||..|:|
Zfish    93 ---------------------------RWQFVGLSKRKSEELLMLPHNQPGSFLIRESETFPGNY 130

  Fly   484 SVSLKAPGRN-----KHFRVHVEQN--MYCIGQRKFHSLDQLVDHYQR-APIYTNKQGEKLYLVR 540
            ::|::..|..     ||:|:....|  .|......|.:|..::.||.. :.......||..:::.
Zfish   131 TLSVRKSGSQERASVKHYRISCIDNGWFYISPGLTFRTLSDMIAHYSEVSDGLCCTLGEPCFIIG 195

  Fly   541 S--LPKANG 547
            |  :|..||
Zfish   196 SNNVPVVNG 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dockNP_001259845.1 SH3_Nck_1 154..204 CDD:212699
SH3_Nck_2 256..308 CDD:212700 3/16 (19%)
SH3_Nck_3 328..383 CDD:212701 14/55 (25%)
SH2_Nck_family 446..538 CDD:198196 26/100 (26%)
sla2bXP_017209080.1 SH3_SLAP-like 36..90 CDD:212782 14/56 (25%)
SH2_SLAP 83..186 CDD:198207 28/162 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170582192
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.