DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dock and grap2b

DIOPT Version :9

Sequence 1:NP_001259845.1 Gene:dock / 33262 FlyBaseID:FBgn0010583 Length:548 Species:Drosophila melanogaster
Sequence 2:NP_956972.1 Gene:grap2b / 393651 ZFINID:ZDB-GENE-040426-1485 Length:249 Species:Danio rerio


Alignment Length:228 Identity:53/228 - (23%)
Similarity:86/228 - (37%) Gaps:86/228 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   333 YSFTSNNDQELSFEKGDRLEIVDRPASDPDWYKARNNQGQVGLVPRNYLQELNDYLATPYRNASA 397
            |.|::....||||.|||.::|:   .::.||::|..| |..|.||||       |:.|.:     
Zfish     7 YDFSATAGDELSFRKGDVIKIL---GTNDDWFRAEIN-GMEGFVPRN-------YIVTTF----- 55

  Fly   398 SAGNGNGGGSNGGAGGGGGNDSMERRNEGNKPAAQSSGQPIERPNLAGKSWYYGAITRS------ 456
                                                            .|||....:|.      
Zfish    56 ------------------------------------------------PSWYKENTSRQSAQDEL 72

  Fly   457 QCDTVLNGHGHDGDFLIRDSETNMGDYSVSLKAPGRNKHFRV-HVEQNMYCIGQRKFHSLDQLVD 520
            .|..:       |.|:||.|:::.||:|:|::.....:||:| ...|..|.:....|.||::|||
Zfish    73 MCQPI-------GAFIIRGSQSSPGDFSISVRHENDVQHFKVMRDRQGRYYLWSEMFTSLNKLVD 130

  Fly   521 HY--------QRAPIYTNKQGEKLYLVRSLPKA 545
            :|        .|..:.|:::....:|.|...:|
Zfish   131 YYTHNSISKQSRVFLLTDQRSSSDFLHRKPTEA 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dockNP_001259845.1 SH3_Nck_1 154..204 CDD:212699
SH3_Nck_2 256..308 CDD:212700
SH3_Nck_3 328..383 CDD:212701 20/49 (41%)
SH2_Nck_family 446..538 CDD:198196 28/106 (26%)
grap2bNP_956972.1 SH3 2..51 CDD:302595 20/54 (37%)
SH2_Grb2_like 54..147 CDD:199828 27/152 (18%)
SH3 197..248 CDD:302595
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170582194
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.