DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dock and Sh2d5

DIOPT Version :9

Sequence 1:NP_001259845.1 Gene:dock / 33262 FlyBaseID:FBgn0010583 Length:548 Species:Drosophila melanogaster
Sequence 2:XP_006239345.1 Gene:Sh2d5 / 366489 RGDID:1305952 Length:429 Species:Rattus norvegicus


Alignment Length:114 Identity:30/114 - (26%)
Similarity:46/114 - (40%) Gaps:23/114 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   414 GGGNDSMERRNEGNKPAAQSSGQPIERPNLAGKSWYYGAITRSQCDTVLNGHGHDGDFLIRDSET 478
            |.|:.|....|||               :|....|.:..::|| |...|......|.||:.....
  Rat   283 GPGSPSCLVENEG---------------SLTENIWAFAGLSRS-CALALLRRDVHGAFLLWPEPG 331

  Fly   479 NMGDYSVSLKAP-GRNKH--FRVHVEQNMYCIGQ--RKFHSLDQLVDHY 522
            ..|.:|:|::.. |...|  ||.|:  ..||:..  .:|.||:.||:.:
  Rat   332 TSGQWSLSVRTQCGVVSHQVFRNHL--GRYCLEHLPAEFPSLEALVESH 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dockNP_001259845.1 SH3_Nck_1 154..204 CDD:212699
SH3_Nck_2 256..308 CDD:212700
SH3_Nck_3 328..383 CDD:212701
SH2_Nck_family 446..538 CDD:198196 23/82 (28%)
Sh2d5XP_006239345.1 PTB_tensin-related 23..150 CDD:269979
SH2 302..378 CDD:198173 23/78 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166342151
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.