DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dock and drk

DIOPT Version :9

Sequence 1:NP_001259845.1 Gene:dock / 33262 FlyBaseID:FBgn0010583 Length:548 Species:Drosophila melanogaster
Sequence 2:NP_476858.1 Gene:drk / 36497 FlyBaseID:FBgn0004638 Length:211 Species:Drosophila melanogaster


Alignment Length:230 Identity:62/230 - (26%)
Similarity:105/230 - (45%) Gaps:76/230 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   330 VALYSFTSNNDQELSFEKGDRLEIVDRPASDPDWYKARNNQGQVGLVPRNYLQELNDYLATPYRN 394
            :|.:.|::..|.||||.|...|:|::. ..|.:||:|..: |:.||:|.||::..|         
  Fly     4 IAKHDFSATADDELSFRKTQILKILNM-EDDSNWYRAELD-GKEGLIPSNYIEMKN--------- 57

  Fly   395 ASASAGNGNGGGSNGGAGGGGGNDSMERRNEGNKPAAQSSGQPIERPNLAGKSWYYGAITRSQCD 459
                                                               ..||||.|||:..:
  Fly    58 ---------------------------------------------------HDWYYGRITRADAE 71

  Fly   460 TVLNGHGHDGDFLIRDSETNMGDYSVSLKAPGRNKHFRV-HVEQNMYCIGQRKFHSLDQLVDHYQ 523
            .:|: :.|:|.||||.||::.||:|:|:|.|...:||:| ...|:.:.:...||:||::||::::
  Fly    72 KLLS-NKHEGAFLIRISESSPGDFSLSVKCPDGVQHFKVLRDAQSKFFLWVVKFNSLNELVEYHR 135

  Fly   524 RAPIYTNKQGEKL-------YLVRSL----PKANG 547
            .|.: :..|..||       .||::|    |:.:|
  Fly   136 TASV-SRSQDVKLRDMIPEEMLVQALYDFVPQESG 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dockNP_001259845.1 SH3_Nck_1 154..204 CDD:212699
SH3_Nck_2 256..308 CDD:212700
SH3_Nck_3 328..383 CDD:212701 20/52 (38%)
SH2_Nck_family 446..538 CDD:198196 36/99 (36%)
drkNP_476858.1 SH3_GRB2_like_N 2..53 CDD:212738 19/50 (38%)
SH2_Grb2_like 56..149 CDD:199828 37/154 (24%)
SH3_GRB2_like_C 156..208 CDD:212739 5/14 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451120
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.