DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dock and Grap

DIOPT Version :9

Sequence 1:NP_001259845.1 Gene:dock / 33262 FlyBaseID:FBgn0010583 Length:548 Species:Drosophila melanogaster
Sequence 2:NP_001020920.1 Gene:Grap / 363616 RGDID:1306884 Length:217 Species:Rattus norvegicus


Alignment Length:204 Identity:59/204 - (28%)
Similarity:88/204 - (43%) Gaps:63/204 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   330 VALYSFTSNNDQELSFEKGDRLEIVDRPASDPDWYKARNNQGQVGLVPRNYLQELNDYLATPYRN 394
            ||||:|.:....||:|.|||.|:|::.. .|.:|||| ..:|..|.||:||::.           
  Rat     4 VALYNFQATESDELAFNKGDTLKILNMD-DDQNWYKA-ELRGAEGFVPKNYIRV----------- 55

  Fly   395 ASASAGNGNGGGSNGGAGGGGGNDSMERRNEGNKPAAQSSGQPIERPNLAGKSWYYGAITRSQCD 459
                                             ||                ..||.|.|:|...:
  Rat    56 ---------------------------------KP----------------HPWYSGRISRQLAE 71

  Fly   460 TVLNGHGHDGDFLIRDSETNMGDYSVSLKAPGRNKHFRVHVE-QNMYCIGQRKFHSLDQLVDHYQ 523
            ..|....|.|.||||:||::.|::|||:....:.:||:|..| ...|.:.:.||:||::|||.|:
  Rat    72 ETLMKRNHLGAFLIRESESSPGEFSVSVNYGDQVQHFKVLREASGKYFLWEEKFNSLNELVDFYR 136

  Fly   524 RAPIYTNKQ 532
            ...|...:|
  Rat   137 TTTIAKRRQ 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dockNP_001259845.1 SH3_Nck_1 154..204 CDD:212699
SH3_Nck_2 256..308 CDD:212700
SH3_Nck_3 328..383 CDD:212701 24/52 (46%)
SH2_Nck_family 446..538 CDD:198196 33/88 (38%)
GrapNP_001020920.1 SH3_GRAP_N 2..55 CDD:212881 24/52 (46%)
SH2_Grb2_like 56..150 CDD:199828 35/106 (33%)
SH3 162..214 CDD:418401
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166342147
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.